SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019572450.1.88060 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019572450.1.88060
Domain Number 1 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.85e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 568-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 400-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 11-67
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-20
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 6 Region: 288-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 233-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000318
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 8 Region: 530-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000011
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 9 Region: 613-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000253
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 10 Region: 447-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000437
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 103-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000104
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 12 Region: 180-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000481
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019572450.1.88060
Sequence length 659
Comment PREDICTED: zinc finger protein 304 isoform X2 [Rhinolophus sinicus]; AA=GCF_001888835.1; RF=representative genome; TAX=89399; STAX=89399; NAME=Rhinolophus sinicus; AL=Scaffold; RT=Major
Sequence
MAAAALTDRALGCVTFEDVFVYFSREEWELLEEAQRCLYRDVMLENFALVASLDCWRGAA
PEDSPSEQSISVGVSQVRTPESGPFIQKAHSCEMCEPLLKGVVHLAEHQDLHPVQKLYTC
DPCGRGLLFDANFDQHQKRYSGENPFNGDEGGASFVNSCAVHILGRPCTCREEGMDLLDS
SGLFQHQPTQCGMSPCKRTEFMESFPHSTSLGQHQEDHDGQMLFNCSDHGKAFLNTFTLL
DKQITHTEVRPFRCLPCGNMSKEKAAVIHHRKIHNGETPHVCKECGKAFIHLSHLKMHQK
FHTGKRHTCSECGKAFSRKDTLVQHQRVHTGERSYDCSECGKAYSRSSHLVQHQRIHTGE
RPYKCGECGKAFSRKDTLVQHQRFHTGERPYECSECGKFFSQSSHLIEHWRIHTGARPYE
CIECGKFFSHNSSLIKHRRVHTGARSYVCSKCGKAFSCKDTLVQHQIIHTGARPYECSEC
GKAFSRKDTLVQHQKIHTGERPYECSECGKFFSHSSNLIVHQRIHTGAKPYECSECGKCF
SHNSSLILHQRVHTGARPYMCSECGKAYISSSHLVQHKKVHTGARPYECSECGKFFSRNS
SLILHQRVHTGEKPYVCSKCGKAYSRSSHLVRHQKVHTGERPKECNSFGGPLAASLKLV
Download sequence
Identical sequences XP_019572450.1.88060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]