SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019579877.1.88060 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019579877.1.88060
Domain Number 1 Region: 2204-2297
Classification Level Classification E-value
Superfamily C-type lectin-like 1.18e-31
Family Link domain 0.00013
Further Details:      
 
Domain Number 2 Region: 510-648
Classification Level Classification E-value
Superfamily FAS1 domain 4.97e-29
Family FAS1 domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1475-1523,1604-1715
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-27
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 4 Region: 1717-1870
Classification Level Classification E-value
Superfamily FAS1 domain 5.49e-26
Family FAS1 domain 0.0049
Further Details:      
 
Domain Number 5 Region: 967-1124
Classification Level Classification E-value
Superfamily FAS1 domain 2.62e-22
Family FAS1 domain 0.0057
Further Details:      
 
Domain Number 6 Region: 386-502
Classification Level Classification E-value
Superfamily FAS1 domain 7.06e-20
Family FAS1 domain 0.0047
Further Details:      
 
Domain Number 7 Region: 2295-2458
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-18
Family FAS1 domain 0.0064
Further Details:      
 
Domain Number 8 Region: 1132-1256
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000000314
Family FAS1 domain 0.007
Further Details:      
 
Domain Number 9 Region: 1547-1584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000293
Family Merozoite surface protein 1 (MSP-1) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019579877.1.88060
Sequence length 2567
Comment PREDICTED: stabilin-1 isoform X2 [Rhinolophus sinicus]; AA=GCF_001888835.1; RF=representative genome; TAX=89399; STAX=89399; NAME=Rhinolophus sinicus; AL=Scaffold; RT=Major
Sequence
MAGPRGLLLLCLLTFCLADSSIIRGQKVRSRRCDVKTKFVTHVPCTMCPAIKKQVCPSGW
LRAFPEKISQDCRYEVQLGDSLVSMSGCSLECWKDMVQKACCPGYWGSQCYECPGGAETP
CNGHGTCLDGIDRNGTCVCQENFSGSACQECQDPNRFGPDCQSVCNCVHGVCRNGPLGDG
SCLCFAGYTGAHCDQELHVCQALRCQQNSQCSAEAPTCSCLPGYSQQGSECRAPDPCQPS
PCSPLAQCSVSPSGQAQCRCPKNYYGNGIVCLPQDPCNTNNGGCPSNSTLCLYKGPGKAS
CTCKPGLVSINHNASAGCFAYCFPHSCDRSATCQVTPDGKTSCVCKEGQVGDGRACYGHL
LHEVQKASPIRAVFLGLRVALAMLDQGCREILTTSGPFTVLVPSLSSINSRIMNASLAQK
LCRQHIIAGQHILEELGTQHQTRTWWTLAGQEITVTFNRFMKYTYKYKDLPQQTFTIHKA
NYPAINGVFHMVTALRWQPPPELPEDPKRTIGQILASTEAFSRFETILENCGLPSILDGP
GPFTVFAPSNEAVDNLRDGRLIYLFTAGLSKLQELVRYHIYGHGQLTVEKLISKGRVLTM
ANQVLAVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGILLPPTILPILPKHCSQEQ
HQIVVGSCVDCQALNATNTCPPNSVKLDISPEECVYVHDPTGLNVLKKGCARYCNQTILK
PGCCKGFFGPDCAQCPGGFSNPCYGKGNCSDGVLGNGACLCFPDYKGIACHICSNPNKHG
DQCQEDCGCVHGLCDNRPGSGGVCQGGTCAPGFSGRFCNESTENCGSTEQAQSCHLHARC
VTQGGIPRCLCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGALGTHHCTCHKGWSG
DGRICVAIDECELDVRGGCHADALCSYVGPGQSRCTCKLGFAGDGYMCSPIDPCRAGNGG
CHDLASCQAVGGGQRVCRCPPGYGGDGFSCYGDIFRELEANAHFSVFYQWIKTAGVTLPA
DKQVTALVPSESAIRRLSPEDQAFWVQPRMLPLLVRAHFLQGAFSEEELARMGGQAMATL
SPTTRWEIRNTSGRVWVQNASVDVADLLATNGVLHVLSQVLLPPREDVLAGKGLLQQLDS
VPAFRLFRELLQHHSLVAQIEAASAYTIFVPTNRSLEAQGNSSSLDADTVRHHVILGEAL
STEALRRGGHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPVLEAPGGSLFGISGVLAVGS
SRCLHSHAESLREKCINCTRKFRCTQGFQLENTPKKSCVYRSGYSFSRGCSYTCAKRIQV
PDCCPGFFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECHCHEGFHGTACEMCELGRYGP
NCTGVCHCVHGLCQEGLRGDGSCVCNVGWQGLRCDQKISGPLCTKKCDPNANCVQDLAAV
PACICAAGYSGNGTYCSEVDPCAHDHGGCSPHANCTKVAPGQRTCTCQDGYTGDGELCQE
ANSCLIRHGGCHVHAECIPTGPEQVSCSCREGYSGDGIRTCELLDPCSQNNGGCSPYAVC
KSSGDGQRTCTCDTAHTVGDGFICRARVSLELLRDKHASFFSLHLLKYNELKGNGPFTIF
VPHADLMTNLSQDELARIGAHRELVFRYHVVGCRQLRSQDLLEEGYVTTLSGHPLRFSER
EGSIYLNDFARVVSSDHQAVNGILHFIDRVLLPPEALHWEPDAAPIPRRNVTAAADSFGY
KIFSSLVKVAGLLPLFRDVSHRPFTMLWPTDSALQALPPDRQAWLYHEDHRDKLAAILRG
HVIRNIEALASDLPNLGPLRTMHGTPISFSCSRARPGELMVGEDDARIVQRHLPFEGGLA
YGIDQLLEPPGLGARCDRFETRPLWLICSICGREPPCPEGSREQGSPQACWRYYSKFWTS
PPLRSLALRSIWGQPQGLGRGCHRNCVTTTWKPSCCPGHYGSECRACPGGASHPCSDHGV
CMDGMSGSGQCRCLSGFAGTACELCAPGAFGPHCQACRCTSHGHCDEGLGGSGSCFCDEG
WTGPRCEVQLELQSACAPPCAPQAVCRTGNSCECSLGYEGDGRTCTVANLCKDGRGGCSE
HANCSQVGTAVNCTCLPDYEGDGWSCRARNPCEDGHRGGCSEHADCLSTGPNMRRCVCHA
GYVGDGVQCLEEPEPPVDRCLGQPPPCHVDAVCTDLHFQEKRAGVFHLQATSGPYSLNFS
EAEVACGAQGAVLASLPQLSAAQQLGFHLCLVGWLANGSAAHPVVFPSADCGDGQVGVVS
LGTRENLSERWDAYCYRVQDVACRCREGFVGDGTSTCNGKLLDVLAATANFSTFYGMLLG
YANATPRGLDFLDFLDNELTYKTLFVPVNEGFVDNMTLSGPDLELHASNTTLLSTNISKG
TLLPSHSGLSLVISDVGPGNSSWAPGAPGAVVVSHVIVWDIMAFNGIIHALASPLLAPPQ
PRAVVAPEVPPMAAGVGAVVAAAALLGLVAGAIYLRARGKATGFGFSAFQAEDDADDDFS
PWQEGTSPTLVSIPNPVFGSHDAFCEPFDDSLLEEDFPDTQRILAVK
Download sequence
Identical sequences XP_019579877.1.88060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]