SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019609933.1.88060 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019609933.1.88060
Domain Number 1 Region: 234-489
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.22e-64
Family Eukaryotic proteases 0.0000000805
Further Details:      
 
Domain Number 2 Region: 52-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-23
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 3 Region: 196-242
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000112
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019609933.1.88060
Sequence length 493
Comment PREDICTED: complement C1r subcomponent-like protein isoform X1 [Rhinolophus sinicus]; AA=GCF_001888835.1; RF=representative genome; TAX=89399; STAX=89399; NAME=Rhinolophus sinicus; AL=Scaffold; RT=Major
Sequence
MRPSREINNGGKLTMKLRLTRRLKELGWERWWLLLWGVLQACPSQGSVLLAQQLPQQLTS
PRYPEPYLKGQETTTVIEAPEGFAVKLIFQDFDLEPSQDCERDSVTITASGMAPRRFCGQ
QDSPLGRPPGQREFVSSGSSLQLTFCAPASSEDRTTHLHKGFLALYQAVSMNHSQPISQV
SGGSETTHTPGDNPYKIQNHCQEPYYQSMPADTLTCTAQGLWKETQDRKEVHHCVPVCGR
PVTPITPNQEAQGSSKAKLGNFPWQAFTNIHGRAGGALLGDRWILTAAHTIYPKDSIFLG
KNPSVDVFLGHTKIDEIIKLGNHPVRRVVVHPDYRQNESRNFDADIALLELQHSVRLGPN
LLPVCLPDNETFYRSGLMGYVSGFGMEMGWLTTELKYSRLPVAPREACEAWLQEKQRTDV
FSDNMFCVGNKTWQQSVCQGDSGGVYVVWDDGAHHWVATGIVSWGIGCGKGYGFYTKVFN
YVDWIKGVMDGKD
Download sequence
Identical sequences XP_019609933.1.88060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]