SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019664318.1.58354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019664318.1.58354
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-25
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 2 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 351-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-23
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 9 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-16
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 126-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000144
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 11 Region: 616-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000244
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 88-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000721
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019664318.1.58354
Sequence length 674
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 724 [Ailuropoda melanoleuca]; AA=GCF_000004335.2; RF=representative genome; TAX=9646; STAX=9646; NAME=Ailuropoda melanoleuca; AL=Scaffold; RT=Minor
Sequence
MATWSLWYFFQGLLTFKDVAIEFSQEEWGCLSHTQRELYRDVMLENYGHLLFLGFILSKP
DLITFLEQEKQLWDVKRKETVAFHPGIKTYIFKECGKSFDCHLMLSQHQQMHTGKKIYKW
EECGKSFKDCSSVNGHRQIHTGEKPYKSKECGKASTLCSTLPGHHIIHSGEKSYKCKDCD
EVFNHFSSLNRHHRIHTGEKHYQCKECGKAFKRLSSLRQHHRIHTGGKPYKCQECGKAFY
KPSHLTEHHRIHTGEKPYKCQDCGKAFNRHSHLTRHHRFHTGEKPYKYKESAKAFNSFST
LTQHHQRHTGEDTYQCKVCGKAFKCSADLTQHRRIHTGEKPYKCQECGKDFKWPSELTRH
HRIHTEEKPYQCNDCGKAYKWPSDLTHHRRIHSGEKPYKCQECGKAFNKPSELTEHHRIH
TGENPYRCQDCGKSFNSPSRLTEHHRIHTGEKPYKCQECGKAFNRHSHLTRHQRFHTGQK
TYKCQECSKAFNSRSNLTQHYRMHTSEKSYKCKECGKAFKRLSALSQHHRIHTGEKPYKC
PECGKAFNSPSHLTEHHRIHTGEKPYKCQECGKAFNRQSHLTRHHRIHTGEKCXECQECA
RAFKSCSAVTHHHQMHTGEKLYKCQVCGKAFNSPSNLTQHRIHTGXKRYQCKQCEKMFKE
CTPPIAHQRIQIGQ
Download sequence
Identical sequences XP_019664318.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]