SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019678183.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019678183.1.62641
Domain Number 1 Region: 2209-2302
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-32
Family Link domain 0.0001
Further Details:      
 
Domain Number 2 Region: 1473-1521,1599-1713
Classification Level Classification E-value
Superfamily FAS1 domain 1.31e-28
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 3 Region: 509-647
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-28
Family FAS1 domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1714-1868
Classification Level Classification E-value
Superfamily FAS1 domain 1.19e-25
Family FAS1 domain 0.0059
Further Details:      
 
Domain Number 5 Region: 965-1122
Classification Level Classification E-value
Superfamily FAS1 domain 9.81e-23
Family FAS1 domain 0.0045
Further Details:      
 
Domain Number 6 Region: 386-501
Classification Level Classification E-value
Superfamily FAS1 domain 8.89e-21
Family FAS1 domain 0.0056
Further Details:      
 
Domain Number 7 Region: 2300-2462
Classification Level Classification E-value
Superfamily FAS1 domain 2.49e-16
Family FAS1 domain 0.0075
Further Details:      
 
Domain Number 8 Region: 1130-1254
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000968
Family FAS1 domain 0.008
Further Details:      
 
Domain Number 9 Region: 1545-1582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000933
Family Merozoite surface protein 1 (MSP-1) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019678183.1.62641
Sequence length 2606
Comment PREDICTED: stabilin-1 isoform X2 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MAGPRGRLLLCLLAFCLAGSSFTRGQKVRSRRCDVKTKFVMRIPCTMCPAIKRRMCPPGW
LRELPEKISQDCRYEVQLGDSLMSMSGCSMECWKDVVEKACCPGYWGSQCYECPGGAETP
CNGRGTCLDGIDGNGTCVCQENFSGSSCQECQDPSRFGPNCQSVCSCVHGVCSHGPLGDG
SCLCFAGYTGARCDQELPICQALNCPQNSQCSAEAPACSCLPGHTQQGRECRAPNPCQPS
PCSPLAQCSVSPTGQAQCRCPKDYHGDGTVCLPHDPCTINHGGCPINSTVCLYLRSGKAS
CQCKPGLVSINHNASAGCFAYCFPHSCDRSATCQVTSDGKTSCVCKEGEVGDGRACYGHL
LHEIQKASQLGVVFLRLRVTLAMLDQGCREILTTSGPFTVLVPSLSSVFSRTMNASVARQ
LCKQHIIAGQHILEELGTQQTRRWWTLDGQELTVTFNHFMKYTYKYKEHPQQTFTIQKAN
YPAANGVFHLVTALQWQPPPELPEDPKRTIGQILASTEAFSRFETILENCGLPSILDGPG
PFTVFVPSNEAVDMLRDGRLIYLFTAGLSKLQELVKYHIYSHGQLTIEKLISKGRVLTMA
NQVLAVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGVLLPPTILPILPKHCNEEQY
KIVAGSCVDCQALNTSMCPPNSMKLDIFPKECVYTHDPTGLNVLKKGCAHYCNQTILKPG
CCKGFFGPDCIQCPGGFSNPCYGKGTCSDGVRGNGACLCFPDYKGIACHICSNPNKHGDQ
CQEDCGCVHGLCDNRPGSGGVCQRGTCAPGFSGHFCNESSVNCGPTERAQSCHLHARCVS
QGGVTRCVCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGALGNHHCTCHKGWSGDG
RVCVAIDECELDVRGGCHADALCSYVGPGQSRCTCKLGFAGDGYVCSPIDPCRAGNGGCH
DLATCQAVGGGQRVCTCPSGYGGDGFNCYGDIFRELEANAHFSVFYQWIKSAGITLPTDS
RVTALVPSESAIRRLSPEDQAFWLQPRMLPHLVRAHFLQGALSEEELARLAGQDVATLSP
TTRWEIHNISGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRGDALHGQGLLQQLDSVP
AFHLFRELLQHHSLVPQIEAATAYTIFVPTNRSLEAQGNSSILDADTVRHHVILGEALST
ESLQKGGHRNSLLGPAHWLVFYNHSGQPEVNHMPLEGPVLEAPGRSLFGLSGVLTVGSSR
CLHSHAESLREKCINCTRKFRCTQGFQLENTPRKSCVYRSGYSFSRGCSYTCAKKIQVPD
CCPGFFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECHCHEGFHGTACEMCELGRYGPTC
AGVCDCAHGLCQEGLQGDGSCVCHAGWQGPRCDQKISGPQCPKKCDPNANCVQDSATAPA
CVCAAGYSGDGVHCSEVDPCARDHGGCSPHANCTKVAPGQRTCTCQDGYTGDGELCQEVN
SCLIHHGGCHMHAECIPTGPQQVSCSCREGYSGDGIRTCELLDPCSQSNGGCSPYAVCKS
TGDGQRTCTCDAAHTVGDGFTCRARVGLELLRDRHASFFSLHLLEYKELKGDGPFTVFVP
RADLMSNLSQDELAPIRAHRQLVFRYHVVGCRQLRSQELLDEGYVTTLSGHTLRIHEREG
SIYLNDFARVVSSDHEAVNGVLHFIDRVLLPPDVLYWKPDVAPILRRNVTAAAESFGYKI
FSGLVKVAGLLPLLQDAAHRPLTMLWPTDSALQALPPDRQAWLYHEDHRDKLAAILRGHV
IRNIEALASDLPNLGPLRTMHGTPISFSCSRVRPGELTVGEEDARIMQRHLPFEGGLAYG
IDQLLEPPGLGARCDRFETRPLRLKICSICGLEPPCPEGSREQGSPETCWRYYSKFWTSP
PLHSLALRSIWARSSLWGQPQGLGRGCHRNCVTTTWKPSCCPGHYGSECRACPGGASSPC
GGHGVCMDGMSGSGQCQCHARFTGTACELCASGAFGPQCQACRCTSHGRCDEGLGGSGSC
FCDEGWTGPSCEVQLKLQPVCAPPCAPEAVCRAGNSCECGLGYEGDGRSCTVADLCRDGH
GGCSEHATCSQAGTVVTCTCLPAYEGDGWSCRARDPCADGHRGGCSEHADCLNTGPNTRR
CVCHAGYVGDGLQCLEEPEPPVDRCLGQPPPCHVDAVCTDLHFQEKQAGVFHLQAPSGPY
GLNFSEAKAACGAQGAVLASLPQLSAAQKLGFHLCRVGWLANGSAAHPVVFPAADCGGGQ
LGVISLGLRKNHSERWDTYCYREQDVACRCRQGFVGDGTSVCNGKLLDVLAATANFSTFY
GMLLGYANATPRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNTTFLST
NASQDTVLPAHSGLSLFFSAVGPDNSSWAPVAPGAVVVSHVVVWDIMAFNGIIHALARPL
LAPLQPQAAVAPEGPPVVAGVGAVVAAGALLGLVAGAFYLRARGQATGFGFSTFQAEDDA
EDDFSPWQEGTSPTLVSVPNPVFGSPDAFGLTPGGGLPGHPADPHGQVMHLGPNRGTSRR
ETTFIARPGTTPSIGGAGGVRTYSGQ
Download sequence
Identical sequences XP_019678183.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]