SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019683735.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019683735.1.62641
Domain Number 1 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 489-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 5 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.59e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 155-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 213-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 8 Region: 37-90
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 9 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-18
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 10 Region: 601-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 643-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 120-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000359
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019683735.1.62641
Sequence length 704
Comment PREDICTED: zinc finger protein 431-like isoform X3 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MESSLQERSLWGHPSDEPSQEPLTGPQDLSALIPYKEQESVTYKDVAVDFTQEEWALMDT
SQRTLYRDVTLENISHLVSVGMKNSHNKQEIIPMQDICMNDPPNCWTVQKCHTGEDLSVY
SGFDEVFTHTYTLTQHVLTHTVRKPYKCNECGKHFTRNANLRTHKITHTGENPFACNQCG
RRFRYFSSLTRHKRIHTGEKPYECRLCGKAFVRSSIKRHERTHTGEKPFKCHLCGKGFVT
RSNLREHERTHTGEKPYTCHQCGKAFVTSSNLREHERTHSGEKPYKCHLCGKAFVQSSCL
RDHERIHTGEKPYKCPICGRAFVTSSCLRKHERTHTGERPYACHLCGKAFIQSSNLRDHE
RTHTGEKPYTCHLCGKAFVTSSNLREHERTHSGEKPYKCHLCGKAFVQSSYLRDHERTHT
GEKPYKCHLCGKAFVTSSCLRKHERTHTGEKPYTCHLCGKSFVQSSNLREHERTHTGEKP
YKCHLCGKAFVTSSNLRKHEKTHTGEKPYTCHLCGKAFVQSSYLREHERIHTGEKPYTCH
LCGKAFVQSSCLRKHERAHTGEEQYICHLCGKAFVTSSDLRDHEGTHTGEEQYICHLCGK
AFVTNSDLRDHEDTHTGEEQYICHLCGKAFVTNSDLRDHEGTHTGEEQYICHLCGKAFVT
NSDLRDHEGTHTGEEQYICHLCGKAFVTSSDLRDHEGTHFNYSE
Download sequence
Identical sequences XP_019683735.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]