SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019683736.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019683736.1.62641
Domain Number 1 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 5 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.59e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 154-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.81e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 212-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 8 Region: 37-90
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 9 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-18
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 10 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 642-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 119-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000284
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019683736.1.62641
Sequence length 703
Comment PREDICTED: zinc finger protein 596-like isoform X4 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MESSLQERSLWGHPSDEPSQEPLTGPQDLSALIPYKEQESVTYKDVAVDFTQEEWALMDT
SQRTLYRDVTLENISHLVSVGMKNSHNKQEIIPMQDICMNDPPNCWTVKCHTGEDLSVYS
GFDEVFTHTYTLTQHVLTHTVRKPYKCNECGKHFTRNANLRTHKITHTGENPFACNQCGR
RFRYFSSLTRHKRIHTGEKPYECRLCGKAFVRSSIKRHERTHTGEKPFKCHLCGKGFVTR
SNLREHERTHTGEKPYTCHQCGKAFVTSSNLREHERTHSGEKPYKCHLCGKAFVQSSCLR
DHERIHTGEKPYKCPICGRAFVTSSCLRKHERTHTGERPYACHLCGKAFIQSSNLRDHER
THTGEKPYTCHLCGKAFVTSSNLREHERTHSGEKPYKCHLCGKAFVQSSYLRDHERTHTG
EKPYKCHLCGKAFVTSSCLRKHERTHTGEKPYTCHLCGKSFVQSSNLREHERTHTGEKPY
KCHLCGKAFVTSSNLRKHEKTHTGEKPYTCHLCGKAFVQSSYLREHERIHTGEKPYTCHL
CGKAFVQSSCLRKHERAHTGEEQYICHLCGKAFVTSSDLRDHEGTHTGEEQYICHLCGKA
FVTNSDLRDHEDTHTGEEQYICHLCGKAFVTNSDLRDHEGTHTGEEQYICHLCGKAFVTN
SDLRDHEGTHTGEEQYICHLCGKAFVTSSDLRDHEGTHFNYSE
Download sequence
Identical sequences XP_019683736.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]