SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019685913.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019685913.1.62641
Domain Number 1 Region: 8-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-21
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 690-700,821-862
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000288
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019685913.1.62641
Sequence length 1165
Comment PREDICTED: large proline-rich protein BAG6 isoform X1 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MEPSDTTSTTTSMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQR
LIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPSGASSGIGSASATHGGGPPPGTR
GPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQT
LLSRMECRGGPQAQHSQPPPQTPTVAPESVALSSQASEPVESEVPPREPMEAEEVEERAP
AQSPELTPSGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGA
AATTDYNNNQEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSH
YTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTSNAEAAPPGPGQASSLAPTSTTVESS
TEGVPPPGPAPPPTTSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPG
HGQTLGSTLIQLPSLPPEFMHAVAHQITHQAMVAAVASAAAGQQVPGFPTAPTRVVIARP
TPPQARPSHPGGPPISGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPPA
PATASASAGTTNTATTAGPAPGGPAQPPPPQPSAADLQFSQLLGNLLGPAGPGAGGPGMA
SPTITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSP
GGLGLESLSPEFFTSVVQGVLNSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGAL
GFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPGNIRTAT
HTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLEL
CNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEH
MPVGPDAILRYVRRVGDPPQPLPEEPMEVQGSERTSPEPQRENASPAPGTTAEEAMSRGP
PPAPEGGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMP
AKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRADIQ
KRLQEDPNYSPQRFPNAHRAFADDP
Download sequence
Identical sequences M3W2A9
XP_006931614.1.62641 XP_019685913.1.62641 ENSFCAP00000004157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]