SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019686843.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_019686843.1.62641
Domain Number - Region: 209-219,299-336
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0191
Family Formin homology 2 domain (FH2 domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019686843.1.62641
Sequence length 360
Comment PREDICTED: mitochondrial fission regulator 2 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MSLILNILREMLEYFGVPIDQVLQIRENKDYGSARSIVRLIGKILPLEPCPRPNFELIPL
LNSVDPGDYGSVVPSFADTLRVANDEEGSYLRFRNSIWKNEEEKKMELFHPLPPVWNPLL
PAPRQNKRTKNDGPVNEAAIKKIAALEDELTFLRTQIAAVVQMQELKNRANAGLFDLSSE
PSSLGQRPSPGTAELSVKPDPFSSSVFFPPPAPPPPVPPQLSSPQRPCSLTWPGTNNTCN
SDNSANEVKRQQSGDSKTNDSHRSKSQENKDVPNMLDILKDMNKVKLRAVERSPGGRPIH
KRKRQDSHWDPVSLISHALKQKFAFQEDDSFEKENRSWESSPFSSPETSRVSYNNVKLIF
Download sequence
Identical sequences XP_006932105.1.62641 XP_011280898.1.62641 XP_019686843.1.62641 ENSFCAP00000020338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]