SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019687614.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019687614.1.62641
Domain Number 1 Region: 207-321
Classification Level Classification E-value
Superfamily ARID-like 1.06e-35
Family ARID domain 0.00000215
Further Details:      
 
Weak hits

Sequence:  XP_019687614.1.62641
Domain Number - Region: 10-18
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00523
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019687614.1.62641
Sequence length 557
Comment PREDICTED: AT-rich interactive domain-containing protein 3B isoform X4 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MEPLQQQKQPPPPPPPPPHLAPLQMDAREKQGQQMREAPFLYAQKLVAQQTLLSATPGRS
SGSPALGPLARVPPATAVARVFERSNVNSEPEEEEGGLEDEDGDDEVAEVAEKEAQAPSK
YFHVQKVVRQDPRAAPVSGLLPAPGLPPRGQQAKEDHTKDASKAPPSVSTAGQPSWNLDE
QLKQNGGLAWSDDADGGRGREISRDFAKLYELDGDPERKEFLDDLFVFMQKRGTPINRIP
IMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLY
AYECEKKALSSPAELQAAIDGNRREGRRPSYSSSLFGYSPAAATAATAGAPALLSPPKIR
FPILGLGSSSGANASSPRISPATTLRKGDGVPVTTVPVPNRLAVPVTLAGQQAGPRTAAL
EQLRERLESGEPPEKKASRLSEEEQRLVQQAFQRSLLSMARQLPMKIRINGREDRTEASA
AALNLATGSIGSINMSVDIDGTTYAGVLFAQKPVVHLIAGSAAQSMGGSGSGSSHCSASP
TSSRGTPSAEPSTSWSL
Download sequence
Identical sequences ENSFCAP00000001860 XP_019687614.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]