SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019691246.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019691246.1.62641
Domain Number 1 Region: 523-742
Classification Level Classification E-value
Superfamily Bet v1-like 3.37e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 94-242
Classification Level Classification E-value
Superfamily PH domain-like 8.05e-28
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019691246.1.62641
Sequence length 751
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X3 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MQQNGDPTPSPFSAPPTFLPGVTWENRRGLSSGGGAGRSAGVTATAAADGWKGRLPSPLV
LLPRSARCQARRRRRSGRTSCFLQLPPAPERALFPSPSPDPSPRLLGASSGAAQGAGAGL
PLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLS
YYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIE
QHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCR
QVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLFPHVTP
RGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKRRRIEEAYKN
AMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTSM
PSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDVG
GDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWET
TIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVCNFSV
DHDSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASV
LRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences ENSFCAP00000020363 XP_019691246.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]