SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019744612.1.30352 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019744612.1.30352
Domain Number 1 Region: 459-593
Classification Level Classification E-value
Superfamily TIMP-like 1.02e-25
Family Netrin-like domain (NTR/C345C module) 0.022
Further Details:      
 
Domain Number 2 Region: 234-330
Classification Level Classification E-value
Superfamily Immunoglobulin 4.08e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 413-466
Classification Level Classification E-value
Superfamily BPTI-like 2.7e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0038
Further Details:      
 
Domain Number 4 Region: 348-407
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000369
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.027
Further Details:      
 
Domain Number 5 Region: 150-202
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000624
Family Ovomucoid domain III-like 0.031
Further Details:      
 
Domain Number 6 Region: 59-106
Classification Level Classification E-value
Superfamily Elafin-like 0.000000209
Family Elafin-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019744612.1.30352
Sequence length 596
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Hippocampus comes]; AA=GCF_001891065.1; RF=representative genome; TAX=109280; STAX=109280; NAME=Hippocampus comes; AL=Scaffold; RT=Major
Sequence
MYKTLRPLLDYRCAKKKNKIWRRALNPNRQDLVWIGVCLRTFLLWQLLGFSLGASVSAPK
VEHEGLCPNKLNTNLWVDAQSTCERECNVDEDCADFEKCCTNVCGLNSCVAARFSDGTTA
QPGDLGRGKGAAAPGSTATCDEFICSQQGATCDIWDGQPICKCQDRCEKEPNFTCASDGL
TYFNRCYMDAEACIRGVTLTVVTCRFYLAGPHTSPLPQDTTAYPTPTSSQEDPMPPTLYS
NPHHQSIYVGGTVSFHCDVIGIPRPDVTWEKQSERREKLVMRPDQMYGNVVITNIGQLVI
YNAQVWDTGIYTCIARNSAGVLRADYPLSVIRRADDDFSEDPEMPMGRPFSPADCLADVD
TRVCSGERHVDWYYDSKLGSCMAFSNGGCEDSRNRFETYEECKASCQREGIGICSLPLVQ
GPCKAWEVRWAWNSVIKRCQAFAYGGCHGNANSFGTLKECEANCPTPKKKPCKTCRVKGK
MVPSLCRSDFAIVGRLTELVEDLDSGLARFSLEEVLRDEKMGLTFFNTKHLEVTIDKIDW
SCPCPNITVEENPLLVMGVVQDGMAIIQSDSYVRAITDRRLKKLREVLAKKTCQTL
Download sequence
Identical sequences XP_019744612.1.30352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]