SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019767151.1.59312 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019767151.1.59312
Domain Number 1 Region: 639-854
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-54
Family DBL homology domain (DH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 88-200
Classification Level Classification E-value
Superfamily BRCT domain 3.21e-18
Family DNA topoisomerase II binding protein 1, TopBP1 0.077
Further Details:      
 
Domain Number 3 Region: 217-273
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000183
Family DNA ligase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019767151.1.59312
Sequence length 1126
Comment PREDICTED: protein ECT2 isoform X1 [Dendroctonus ponderosae]; AA=GCF_000355655.1; RF=representative genome; TAX=77166; STAX=77166; NAME=Dendroctonus ponderosae; AL=Scaffold; RT=Major
Sequence
MDENNAQIQAQGSVCSDSTAEEAHKSDDYDRRICLIGGLANDSGLQSVAESFEVPVVHSQ
DGREYMNDTACCTYYIIDNFDGSLFNSLCKCRQIILGPPALQQLGRKDPKELPDNTRPLF
NLAMRGVVVCFTGFRNKDVLTKLVPLIHHMGGSIRRDMTAKVTHLIANSCGGDKYQYAST
FKVPVMNLQWVLDSWEQNRWDLDFSASQEMFMNIYRLKPFHGAKVCFLGFPEDEEHHMTE
VLLSNGGTVTTLDDPNCSHVVMESAEMYRLEAANTPLSPKLKSNLKSFLSEPAGLPALKT
PNNNSIADFSCLPGSSSTVCLETLQEVSRNDDLVSVMDSICFEDQSLNLSVKRKRKFVSP
DNTLVKRKRDKCYSERRKRVSNFFKTPISYFSNRRRTIDASSFDHSLNDSVVSTSTVFTT
DAVDNLNTCLDCETTPRPKLRKSKKNLFTRTFSSSRFARPKSSKSLMTSFGAEDELNASC
FPDISLNPHSLQSDNGSENAAASRTTSALAVVDEASVVERPDVTGPRAFVVKAEWFWTSV
QKECSLDEKEYLFDDYIEHIVSPAARRDSHATPSSASRRKRKRLHDTLQSLVQQTQSPAL
HKRRSSVSDAGRLSVSGSFLDCTASPAEPGIVEGGDAQVESPRKNVTTRQQVVLELLETE
KNYVEILRTIVSLFKNYLELMPDEEALLNNTELNLIFGKLPPIYETHVKILDELRWTIAH
WHEERSIGNIIIKYSTELQRAYPPFINYFEEMKEVLTSCDQSKPRFHAFLKAMQTKPECG
RQSLQELMIRPVQRLGSISLLLKDILKHTAKTNPDHAAVEKALAALREVMAHINEDKRKA
EGQVTLFNIFNEIDNCPPDIVSSHRSYITKVEVVQLSSSEGLSSKGSSLVLFVFSDQLEV
CKKKSKTTMKSPSASGFQLQGRPNVKLYKHVKMMNLNTIKRVIDIKETEACQKVFSLVCK
SSEESKEKLFSFAMTDEYPDKVGFLKLLTRTMANNVCSADADKFMAYLEPQQLDIDTNDI
TNGTLSKYLNFAKSRLKVGRTFSFNKSTPSKLKRAVSSMMSPFGSSTNLTPASQLANMRL
ASYSNINELANNGENSDESPPTAPMSVQPTRKAKAASLGANAFQRL
Download sequence
Identical sequences XP_019767151.1.59312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]