SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019786176.1.83887 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019786176.1.83887
Domain Number 1 Region: 49-140
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.25e-39
Family SCAN domain 0.0000508
Further Details:      
 
Domain Number 2 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 384-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 485-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 223-269
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000157
Family KRAB domain (Kruppel-associated box) 0.0084
Further Details:      
 
Domain Number 6 Region: 353-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000441
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019786176.1.83887
Sequence length 561
Comment PREDICTED: zinc finger protein with KRAB and SCAN domains 1 isoform X1 [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence
MMTAESREATGLSPHAAQEKDGIVIVKVEEEDEEEHVWGQDASLQESPPPDPEIFRQRFR
HFCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYR
PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSFDLPHEATQSHF
KHSSRKPRLLQPRALPATHVPAPQHEGGPRDQAMASALFSADSQAMVKIEDMAVSLILEE
WGCQNLARRNLNRDTRQENYGNVISQGCEKNEESTSKAEIAEDSASHGETTGKFQKDFGE
KRDQQGRVVERQQRNPEEKTGKEKRDPGPATVKEKKNPSTGERGPREKGKGLGRSFSLSS
NFNTPEEVPTGAKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNLVL
HQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRI
HTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHTRE
RASEYSPASLDAFGAFLKSCV
Download sequence
Identical sequences XP_019786176.1.83887 XP_019786177.1.83887 ENSTTRP00000011673 ENSTTRP00000011673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]