SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019786196.1.83887 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019786196.1.83887
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-27
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 335-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-21
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 4 Region: 47-96
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.18e-20
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 378-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 256-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000104
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 175-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000015
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019786196.1.83887
Sequence length 447
Comment PREDICTED: zinc finger protein 3 [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence
METQADRVSQEPQALLESALPSSKVPAFSDKDSLGDEMLAAALLKAKAQELVTFEDVAVY
FIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDGETRTEHDPEISEDTGSHGVLLGRFQKD
ISQGLKFEEAYEQEVSLKRQLGSSSGERLNRKIQDFGQVTVEEKRTPVGGRSEKYSDLGN
SFTVSSNLISQQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQ
SSHLIQHQRIHTGEKPYECNDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTL
THHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQ
RIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHT
GEKPLNVMGVSKSSLRVTAELNIREST
Download sequence
Identical sequences ENSTTRP00000011677 XP_019786196.1.83887 ENSTTRP00000011677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]