SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019787512.1.83887 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019787512.1.83887
Domain Number 1 Region: 52-178
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.96e-46
Family Regulator of G-protein signaling, RGS 0.000000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019787512.1.83887
Sequence length 205
Comment PREDICTED: regulator of G-protein signaling 4 [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHSKRDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLANL
SSCGSEKQKGAKSSTDCPSLVPQCA
Download sequence
Identical sequences XP_019787512.1.83887 ENSTTRP00000001209 ENSTTRP00000001209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]