SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019799296.1.83887 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019799296.1.83887
Domain Number 1 Region: 223-465
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-50
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 64-177
Classification Level Classification E-value
Superfamily POZ domain 8.63e-28
Family Tetramerization domain of potassium channels 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019799296.1.83887
Sequence length 514
Comment PREDICTED: potassium voltage-gated channel subfamily G member 1 [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence
MTLLPGDNSDYDYSALSCASDASFHPAFFPQSQSLKGVFYRRAQRLRPQDEPRQGGQPED
RRRQIIINVGGIKYSLPWTTLEEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMV
EREDEDDPLDSEDHDSEGPTEGEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
AVNLSISTLPSLREEEEKGQCSQMCRNIFIVESVCVGWFSLEFLLRLIQAPSKFAFLRSP
LTLIDMVAILPYYITLLVDGAAADRRKPGTGNSYLDKVGLVLRVLRALRILYVMRLARHS
LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFR
RTQFLIKTKSQLSSMSHDSDILFGSASSDTRDNN
Download sequence
Identical sequences ENSTTRP00000010081 XP_019799296.1.83887 ENSTTRP00000010081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]