SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019810991.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019810991.1.53367
Domain Number 1 Region: 83-507
Classification Level Classification E-value
Superfamily Sema domain 6.15e-94
Family Sema domain 0.00077
Further Details:      
 
Domain Number 2 Region: 1408-1531,1687-1872
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4e-39
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 867-962
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000504
Family Other IPT/TIG domains 0.026
Further Details:      
 
Domain Number 4 Region: 959-1048
Classification Level Classification E-value
Superfamily E set domains 0.000000000000546
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 5 Region: 510-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000209
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1047-1091,1128-1181
Classification Level Classification E-value
Superfamily E set domains 0.0000000738
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019810991.1.53367
Sequence length 1906
Comment PREDICTED: plexin-B3 [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MGPSLDCLPPTQDNAPYRHPVSVTTAPGQLNPGGVCHATQEMPLLLLSARGPEMAPRHLL
GARLLLMLPLLCLPPTPTGAHHFSAPNTTLHHLALAPGQGALYVGAVNRLFQLSPELQLE
SVAITGPVLDSPDCVPFRDPAECPQARLTDNTNQLLLVSGRARELVACGQVRQGVCEKRR
LEDVAELLYRAEDPGDGQFVAANTLGVPTVGLVVSGPDRDLLLVARGLAGKLSAGVPPMX
XXXXAGPQPFSSEGLGRLVVGDLSDYNNSYVAALADAQSAYFVFRRRGDRAQAEYRSYVA
RVCLRDANLYSYVEVPLSCRGHGLVQAAALAPGALLGAFAAGLRGVQAALCAFPLAELDA
SMERARRLCYTAGGRGPSGTEEATVEYGVTSRCVTLPPDSPESYPCGDEHTPSPIAGRQP
VEAGPLLQLKHSISAVAALQADGHTIAFLGDVRGQLHKVFLNGTQGQVYHSQQVGTPGSA
ISPDLLVDSSGSHLYVLTSQQVARVPVAACPQLPDCSSCLQAQDPLCGWCVLQGRCTRKS
QCRRATQPNQWLWTYADGLCLHIESVLPAHHPRQEQGQVTLSVPRLPTLATDEYFHCAFG
NYDSLAHVEGPQVACVTPPQDQLPLNPPGTDHITLPLALMFEDVTVAATNFSFYDCSAVT
ALEAAAPCRACVGSLWRCHWCPQSSHCVYGERCPEGERTIYSTQEADIQVRGPGACPRVE
GLVGPLLVPVGWESRLALRVQNLQHFQGLPASYHCWLELPGQLQRLPASLEEVAGDSGLI
HCQAQQFQPSMVQRELPVPIYVTRGEGQRLDNAHSLHVTLYDCAVGHPDCSHCQAANGSL
GCLWCSHGQPACRYGPLCPPGAVETLCPTPRIETVEPLTGPPEGGLVLTIQGSNLGRDFA
DVQDAVSVAGWPCRPEPSLYRISTRIVCVTSPAPNRTMGPIQVAIKGRPPGISTQYFTYQ
DPVLLSLSPQRGPQAGGTQLTIHGQRLQTGGNISXFVGSQPCPIQEPVCPEAIVCHTMPQ
ASPGDAVVRVVFGQAQRLLLTSPFHYTANPQLVAAEPSVSFRGGGRLIRVRGTGLDVVQQ
PLLSVWLETSEGTAVKLQSQDLTPRSGCEVPAAAPQACTQLERGWLQCSSVCSINSSTLL
LCRSPAVPDTASPRRVFFSLDNVHVDFASASGGQDFLYQPNPRLAPLHHEGGPTRPYRLK
PGHILDVEGEGLNLAISKEEVHVHIGDGECLVKTLTLTHLYCEPPPRVPQPSNGSGTLLQ
FVVQMGNVRLALGPVQYEVEPVLSAFPVEAQVGLGVGAALLITAVLLLTLMYRHKSKQAL
RDYQKVLVQLENLEIGVGDQCRKEFTDLMTEMTDLSSDLEASGIPFVDYRTYTERVLFPG
RSGGTLQPAVEGLGEEGHRAPVHQGLMQLSNLLNSKLFLLTLIHTLEGQPSFSQRDRCHV
ASLLSLALHSKLEYLTEIMRTLLSDLASHYVRKNPKLMLRRTETMAEKLLTNWVSICLYA
FLREVAGEPIYMLLRAIQYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFRALTEWAVGSL
APPGPLPAPPEWRSGLAGHLTLSDEDVTSVTQNRWKRLNTLQHYKVPDGATVRLIPQLHN
GGGIISQSLAPSCPSGENTPMLEDSEEGGVHLWHLVKAPEEPEAAKARRSSLRDRDRERA
RAKAIPEIYLTRLLSMKGTLQKFVDDAFQAILSVNRPVPIAVKYLFDFLDELAEKHSIED
PETLHIWKTNSLLLRFWVNTLKNPQLIFDVRVSDNVDAVLAVIAQTFMDSCTVSEHKVGR
DSPVNKLLYAREIPRYKQMVERYYSDIRQSPPASYQEMNSALTELSGNYTSAPHCLQALQ
ELYTHIHRYYDQIIGALEEDPVGQKMQLACRLQQMAALVENKVTEL
Download sequence
Identical sequences XP_019810991.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]