SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019815138.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019815138.1.53367
Domain Number 1 Region: 297-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-17
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 258-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019815138.1.53367
Sequence length 476
Comment PREDICTED: fez family zinc finger protein 1 isoform X1 [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MDSSCHNATAKMLATAPARGNVMNTSKPLAFSIERIMARTPEPKALPVPHFLQGAVPKGD
PKHSLHLNSSIPCMIPFVPVAYDTNPKAGMTGAEPRKASLEAPGAPASAPAAPAFSCSDL
LNCALSLKSDLARDALPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAAGVNIHP
VASYFLSSPLHPQPKTYLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEK
IAFKTSDFSRGSPNTKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQA
STLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYK
NHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVR
KLHDSGLGLPRPSAGEPGADPSPPLQPPPPPATLPPLPPPLPPPGPLQPGLHPGHQ
Download sequence
Identical sequences E1B8C8
ENSBTAP00000006726 9913.ENSBTAP00000006726 NP_001192635.1.59421 NP_001192635.1.76553 XP_019815138.1.53367 ENSBTAP00000006726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]