SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019815604.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019815604.1.53367
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily Lysozyme-like 2.06e-51
Family C-type lysozyme 0.00000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019815604.1.53367
Sequence length 147
Comment PREDICTED: lysozyme C-1 [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MKALIILGFLFLSVAVQGKVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKA
TNYNPGSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCSELMENDIAKAVACAKQIVSE
QGITAWVAWKSHCRDHDVSSYVEGCTL
Download sequence
Identical sequences Q06285
ENSBTAP00000004235 ENSBTAP00000004235 XP_010839853.1.44457 XP_019815604.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]