SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019822874.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019822874.1.53367
Domain Number 1 Region: 43-150
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.8e-27
Family Multidomain sulfurtransferase (rhodanese) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019822874.1.53367
Sequence length 159
Comment PREDICTED: thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 isoform X1 [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MVLQRLLPWSTCRTIFGSAEAVLWGLKSIKRSCLNFCTAICEGVTYKELKNLLKSKKIML
IDVREPWEIYESGKIPGSVNIPLDDVGEALQMNPKDFKEKYKEVKPSKSDSLVFSCLAGV
RSKVAMVTAISLGFNNAQHYAGGWKEWATYEISEKKQGN
Download sequence
Identical sequences A8R4B3
ENSBTAP00000047717 9913.ENSBTAP00000047717 NP_001103564.1.59421 NP_001103564.1.76553 XP_019822874.1.53367 ENSBTAP00000047717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]