SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019823538.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019823538.1.53367
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily EF-hand 2.33e-25
Family S100 proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019823538.1.53367
Sequence length 99
Comment PREDICTED: protein S100-Z [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MPTQLEIAMNIMIRTFHRYSCREGDRFKLNKGELKMLLQRELTEFLSCQKDPELVDKIMQ
DLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGK
Download sequence
Identical sequences F1N4J8
NP_001179595.1.59421 NP_001179595.1.76553 XP_005890147.1.15283 XP_010845919.1.44457 XP_019823538.1.53367 ENSBTAP00000026904 ENSBTAP00000026904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]