SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019824016.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019824016.1.53367
Domain Number 1 Region: 99-298
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 6.02e-23
Family Glycerol-3-phosphate (1)-acyltransferase 0.027
Further Details:      
 
Domain Number 2 Region: 351-416
Classification Level Classification E-value
Superfamily EF-hand 0.0000105
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019824016.1.53367
Sequence length 524
Comment PREDICTED: lysophospholipid acyltransferase LPCAT4 isoform X1 [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MSQGSPGDWAPLDPTPGPPAPPNPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFL
LWPFAWLQVAGLTEEQLQEPITGWRKTVCHHGVLGLSRLLFFLLGFLRIRVRGQRASRLQ
APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRR
VVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTT
SWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYRPSPEESRDPTLYANNVQRVMAQALGIP
ATECEFVESLPVIVVGRLKVALEPQLWELGRVLRKAGLSPGCVDAGTEPGQSRRISQEEF
AKQLQLSDSQTVAGAFSYFQQDADGLVDFRDVALALAALSGGRSLEELTRLAFELFAEEP
EEQAEEQAKGPGRLLYKDGFSTILHLLLGSPRPAARTLHAELCQAGARQGLSLCEFQDFS
LHHPLHGKLFSTYLRPSQTPPASSPGSTTTLANGTVQAPKQKGD
Download sequence
Identical sequences A0JNE8
ENSBTAP00000026698 9913.ENSBTAP00000026698 ENSBTAP00000026698 NP_001071369.1.59421 NP_001071369.1.76553 XP_019824016.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]