SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019825204.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019825204.1.53367
Domain Number 1 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.36e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 8-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 363-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 174-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-18
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019825204.1.53367
Sequence length 425
Comment PREDICTED: zinc finger protein 2 isoform X8 [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MAAVSPTRCQDPVTFEDVAVVFTDEEWRRLVPTQRDLYKEVMLENYKSIVSLGLPVPGPD
VIFQLKRGDEPWLVEFHGFEGKEGAENVSLDWETKPEIQGASEEEKSEGSLKENLGRKGP
PSPKVEVYVLDGRLGTEKESLTVEACKKPPSLEESLRHRATPPKKFLTKERDQECSNCGK
TFFDHSSLIRHQRTHTGEKPYDCPECGKAFSHRSSLSRHLMSHTGESPYECNACGKAFFD
RSSLTVHQRIHTGEKPFKCSECGKAFFDRSSLTRHQRIHTGESPYECNQCGKAFSQKSIL
TRHQLIHTGRKPYECNECGKAFYGVSSLNRHQKAHAGEPRYQCSECGKAFFDRSSLTQHQ
KIHTGDKPYECSECGKAFSQRCRLTRHQRVHTGEKPFECSVCGKVFSSKSSVIQHQRRYA
KQGID
Download sequence
Identical sequences F1N1Y9
XP_010808051.1.76553 XP_019825204.1.53367 ENSBTAP00000049777 ENSBTAP00000002533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]