SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019834708.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019834708.1.53367
Domain Number 1 Region: 44-261
Classification Level Classification E-value
Superfamily EF-hand 3.47e-63
Family Penta-EF-hand proteins 0.0000000784
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019834708.1.53367
Sequence length 263
Comment PREDICTED: calpain small subunit 1 [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MFLVNSFLKGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGTAMRILGGV
ISAISEAAAQYNPEPVPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILN
KVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAVYKQFDVDR
SGTIGSSELPGAFEAAGFRLNEHLYNMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKS
LDKDGTGQIQVNIQEWLQLTMYS
Download sequence
Identical sequences P13135
ENSBTAP00000019803 ENSBTAP00000019803 NP_776686.1.59421 NP_776686.1.76553 XP_019834708.1.53367 9913.ENSBTAP00000019803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]