SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019834911.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019834911.1.53367
Domain Number 1 Region: 32-266
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.46e-85
Family Calponin-homology domain, CH-domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 286-408
Classification Level Classification E-value
Superfamily Spectrin repeat 3.2e-35
Family Spectrin repeat 0.000000586
Further Details:      
 
Domain Number 3 Region: 522-640
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-30
Family Spectrin repeat 0.00000538
Further Details:      
 
Domain Number 4 Region: 409-517
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-25
Family Spectrin repeat 0.0000036
Further Details:      
 
Domain Number 5 Region: 646-758
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-23
Family Spectrin repeat 0.00000291
Further Details:      
 
Domain Number 6 Region: 751-883
Classification Level Classification E-value
Superfamily EF-hand 1.54e-22
Family EF-hand modules in multidomain proteins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019834911.1.53367
Sequence length 911
Comment PREDICTED: alpha-actinin-4 isoform X7 [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MVDYHAANQSYQYGPSSGSNGAGGGGTMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYER
LASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
QTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
NELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLETIDQLHLEYAKRAAPF
NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
NHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANI
VGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
DNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
HGGALGPEEFKACLISLGYDVENDRQGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETT
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKS
FSTALYGESDL
Download sequence
Identical sequences A5D7D1
ENSBTAP00000014894 9913.ENSBTAP00000014894 ENSBTAP00000014894 NP_001091521.1.59421 NP_001091521.1.76553 XP_006068758.1.26621 XP_019834911.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]