SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019835024.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019835024.1.53367
Domain Number 1 Region: 53-322
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.05e-30
Family G proteins 0.023
Further Details:      
 
Domain Number 2 Region: 447-536
Classification Level Classification E-value
Superfamily EF-hand 1.41e-22
Family Eps15 homology domain (EH domain) 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019835024.1.53367
Sequence length 543
Comment PREDICTED: EH domain-containing protein 2 [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MFSWLKRGGARGQQPEAIRTVTSALKELYREKLLPLEEHYRFGTFHSPALEDADFDGKPM
VLVAGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGDTEGTVPGNALVVDPDK
PFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAE
RVDLIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWAL
GKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVKR
ARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPDCQKMQ
ELLMAHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQEELESTDVGVQGGAFEGTHMG
PFVERGPDEALEDGEEGSDDDAEWVVTKDKSKYDEIFYNLAPADGKLSGTKAKTWMVGTK
LPNSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPTNLPRRLVPPSKRRHKG
SAE
Download sequence
Identical sequences Q2KJ47
ENSBTAP00000028239 NP_001039896.1.59421 NP_001039896.1.76553 XP_005900984.1.15283 XP_005960280.1.78601 XP_006067499.1.26621 XP_010850970.1.44457 XP_019835024.1.53367 ENSBTAP00000028239 9913.ENSBTAP00000028239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]