SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019840257.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019840257.1.53367
Domain Number 1 Region: 2205-2299
Classification Level Classification E-value
Superfamily C-type lectin-like 3.39e-31
Family Link domain 0.00016
Further Details:      
 
Domain Number 2 Region: 505-643
Classification Level Classification E-value
Superfamily FAS1 domain 3.4e-29
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1469-1517,1595-1709
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-26
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1710-1864
Classification Level Classification E-value
Superfamily FAS1 domain 2.22e-24
Family FAS1 domain 0.0051
Further Details:      
 
Domain Number 5 Region: 961-1118
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-23
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 6 Region: 384-497
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-19
Family FAS1 domain 0.0084
Further Details:      
 
Domain Number 7 Region: 2296-2459
Classification Level Classification E-value
Superfamily FAS1 domain 6.28e-17
Family FAS1 domain 0.008
Further Details:      
 
Domain Number 8 Region: 1127-1250
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000458
Family FAS1 domain 0.0061
Further Details:      
 
Domain Number 9 Region: 1541-1578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000574
Family Merozoite surface protein 1 (MSP-1) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019840257.1.53367
Sequence length 2568
Comment PREDICTED: stabilin-1 isoform X2 [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MAGPRGHLLLCFLALCLAGPSFFGEQKVRSKRCDVKTKFVTHIPCTPCPAIKKRVCPLGW
IRAFPEKISQDCRYEVQLGDSLLSMSGCSLECWKDMVQKACCPGYWGSQCYECPGGAETP
CSGHGTCLDGLDGNGTCVCQENFSGSACQECRDPNRFGPDCQSVCRCVHGVCRHGPRGDG
SCLCFAGYTGAHCDQELLACQALNCPRNSQCSEEAPSCSCLPGYTQQGHECRASDPCRPS
PCSPLAQCSVGPGGQAQCRCPENYHGDGTVCLPQDPCTTNNGGCPSNSTLCLYRKPGQAS
CLCKPGLVSIAHDSSAGCFAHCSAFSCDRSATCQVTPDGKTSCVCKEGEVGDGRACYGHL
LHEVQKASQTSMLLRLRVTFAMLDQGCREILSTSGPFTVLAPLVSSRTMNASXAQQLCRQ
HIIAGQHMLEEAGTQAPRRWWTLAGQEITVSFSRFRKYTYKYQDQPQQTFTIHKANYPAA
NGLFHVVTALRLQPPPELPEDPKRTIGQILASNEVFSRFETILENCGLPSFLDGPGPFTV
FAPSNEAVDGLRDGRLVYLFTAGLSKLQELVRYHVYNHGQLTVEKLLSKGRVLTMANQIL
AVNISEEGRILLGPEGVPLRXVDVLAANGVIHMLEGVLLPPTILPILPKLCNEEQHAVVA
GSCVDCQALNTSTCPPNSVKLDISPEECVYIHDPTGLNVLKKGCAYYCNQTIQKPGCCKG
FFGPDCLQCPGGFSNPCYGKGNCSDGVQGSGACLCFPDYKGIACHICSNPNKHGDQCQED
CGCVHGLCDNRPGSGGVCQHGTCAPGFSGRFCNESTVSCGSTEQAQQCHPHARCVNQGGV
SRCLCLDGFEGDGFSCTPSDPCSRPDRGGCSENAECVPGXRGAHHCMCHKGWSGDGRVCV
AVDECELDLRGGCHADALCSYVGPGQSRCTCKLGFAGDGYVCSPIDPCRAGNGGCHDLAT
CRAVGGGQRVCTCPPDYGGDGFSCYGDILKELEANAHFSVFYQWIKGAGITLPADSQVTA
LVPSESAIRRLSTEDQAFWLQPRLLPQLVRAHFLQGALSEEELARLHGQNVSTLNPTVRW
EIHNVSGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRRDVLGGQGLLQQLDSVPAFHL
FRELLQRHRLVPQIEAATAYTIFVPTNRSLEAQANSSSLDSDVVRHHVILGEALSTEALG
KGGHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPVLQAPGRSLFGLSGVLTVGSSRCLHS
HAEALREKCVNCSRKFRCTQGYQLEDTPRKSCVYRSGYSFSRGCSYTCAKKIQVPDCCPG
FFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEMCELGRYGPNCTGVC
DCAHGLCQEGLRGDGSCVCNVGWQGLRCDQKISGPQCLQKCDPNANCVQDSAAAPVCVCA
AGYSGDGVSCSAVDPCARDHGGCSPHANCTTVAPGQRTCTCLDGYTGDGELCREANSCLI
RHGGCHMHAECIPTGPQQVSCSCREGYSGDGIRACVLLDPCSQNNGGCSPYAVCKSTGDG
QRTCACDAVRTVGDGFTCRARISLELLRDKHASFFSLHLLEYKDLKGDGPFTVFVPHADL
LTNMSQDELARIRANRQLVFRYHVVGCRQLRSQELLEEGYATALSGHPLRFSEREGNIYI
NDFARVVSSDQEAVNGVLHFIDRVLLPPEVLHWEADAAPAPRRNFTAAAETFGYKIFSGL
VTMAGLLPLLQDSSHRPLTMLWPTDSALQALPPDRQVWLYHKDHRDKLAAILRGHVIRNX
EALASDLPNLGPLRTMHGTPISFSCSHARPGALTVGEDAARIVQRHLPFEGGLAYGIDQL
LEPPGLGARCDRFETRPLWLKVCSICGLEPPCPPGSQEQGSPEACWRYFSKFWTSPPLHS
LALRSVWTRPSHWGHPQGLGRGCYRNCVTTTWKPSCCPGHYGSECRACPGGASNPCNQRG
SCMDGMSGSGECRCHTRFAGTACELCAPGAFGPLCQACNCTSHGRCDEGLGGSGSCFCDE
GWTGPRCEVQLELQPVCAPPCAPQAVCRAGNSCECSLGYEGDGRTCTVVNLCQDGRGGCS
EHANCSQAGTAVTCICWPDYEGDGWSCRARNPCEDGLRGGCSEHADCLNTGPNTRRCVCH
AGYVGDGLQCLLEPEPPVDRCLDRPPPCHADAVCTDLHFQEKRAGVFHLQAPSGPYGLNF
SEAEAACGAQGAVLASLLQLSAAQQLGLHLCLVGWLANGSAAHPVVFPTADCGDGQVGVV
SLGARENLSERWDAYCFRMRDVACRCRDGFVGDGTSVCNGKLLDVLATTANFSIFYGMLL
GYANATPRGLEFLDFLDDERTYKTLFVPVDEAFTDNTTLSGPDLELHASNTTFLSANASQ
GALLPAHSGLSLVIGNLGPGNSSRAPEVPGAVVVSRVIVWDILAFNGIIHTLASPLLAPP
QAWAVVAPEAPPVAAGVGAVVAAGAVLGLVAGALYFRGRSRSAGFGFSAFQAEDAAADDF
SPWQEGTSPPLVSVPNPVFGSHEAFCEPFDDSVLEEDFPDTQRILEVK
Download sequence
Identical sequences XP_019840257.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]