SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019845631.1.45957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019845631.1.45957
Domain Number 1 Region: 636-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 180-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000471
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 374-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000037
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 689-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000093
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 492-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000182
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 6 Region: 608-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000034
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 7 Region: 554-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000124
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019845631.1.45957
Sequence length 1303
Comment PREDICTED: uncharacterized protein LOC105225789 [Bactrocera dorsalis]; AA=GCF_000789215.1; RF=representative genome; TAX=27457; STAX=27457; NAME=Bactrocera dorsalis; strain=Punador; AL=Scaffold; RT=Major
Sequence
MDRQTFEIQWIQDQDDLKTANGQLIVKPQMPSEDELLANDATGGSYHLVTGNDENGDVTN
EVDIDQIAAENLIFMARDGQMVTEIIEASAADNGKVVVSTSDEIDCSEVLQQTGNGFIDS
FVDTTPQMVTEEVITDDWVQHQGEERVEIPADQIICSGSQILLDMEVPLPTVQDEYTALR
PYPCDFCSRRFRKKTSLMNHIVAHQNDRPHLCKLCGSRFFRRSDLINHLKAHADAPDPEL
DTEFMNFVEQEQQQSQLRQPNDHFYEQDWTTHINSLQRSEKSSRKPHNVSGNSSSTSTST
TTGRGRISRIKPKEESYVLNEQHENETVGLANLENPSSAFEDCQQLQASTAVVKFTHNQS
PAHQKSFPVIDESKPFVCQQCGLAFAREKAMLAHTKNHNEDHPHECNQCNEMFWDAGSLQ
EHLKTHQFEDSNSEYDPEEAEAEETQSESESERLYGEFYCSECGMSFHREDLLRRHSKIH
IKTIAECDIDNDKDRHCCNTCGETFAEALDLLAHAEIHARYPPYKCVLCGETFFEELAIK
RHLQSVHPHDMTPNSCILCGKECRDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKRH
MASHRDKSVICDVCQEEFPDGRTLSNHRHSHTNASGKLFPCHECGKTFGSRSSQQIHVRI
HTGERPYGCRFCWKAFADGGTLRKHERIHTGEKPYACSVCSRAFNQRVVLREHIRSHHSG
LDAKRNTYYCTVCSMEMSSSGDLVQHLIQHSDMNTAMQRQPITGPRKYKRRRKLKPHEIA
RLRRESQQNGNGSDIELSDFDMDNVDDLLGITEPIPVSKASKSKRIKVKDSINNNSLMKE
GVDGVILPDNDLLMQSRKPRYKSTSSNSDTLWQTKLINSNTLLSNLENTLQSIDTLVVGS
SVGGATHLDAEERKPKYKSGSEISSGGGSQRTQEVQINKNYNANKARKRTVEKTSTSKTT
RPRMIHTEKLSSTYNEYGRKRSKTVITHREQNGLDLLRPTGRSMVDDYEILSPATELPRQ
ISSSPPRIKQEIGQNNHEESSHQLRGLQYDAHVPNSSRNVDLYDTQFLDAASTLRKEAYE
KFNPSIVNDLEEILRSPIKCDRSERHRFISESSTPFLEDEQHNLIKIEPTSPDLREIVVG
VSGSTGVSASGGSGSGSSNERHYARSARNRTGTMNRKYLEFESDLQTNGTTRHQKRSATT
VNGSSSKSKQTKSNRREKKESSVINQRTTAYSSTYGGSLSTTNDSSFSSLSPTDGVTAVS
AVTATSPPAPTQPERKVRYFECEMCSAVFPDRAQLLDHVPIHI
Download sequence
Identical sequences A0A034VG34
XP_011202714.1.45957 XP_019845630.1.45957 XP_019845631.1.45957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]