SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019863641.1.10788 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019863641.1.10788
Domain Number 1 Region: 55-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000022
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 2 Region: 1-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family Laminin-type module 0.087
Further Details:      
 
Domain Number 3 Region: 121-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 4 Region: 175-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Laminin-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019863641.1.10788
Sequence length 210
Comment PREDICTED: usherin-like, partial [Amphimedon queenslandica]; AA=GCF_000090795.1; RF=representative genome; TAX=400682; STAX=400682; NAME=Amphimedon queenslandica; AL=Scaffold; RT=Major
Sequence
CACYGHASRCSNDLQSICECVHNTQGDRCNECLPLYNNKPWRRGISTQANPCIICNCNNH
ADSCVYNATLDPFPDSFDSGGGGVCTNCQDNTEGRYCESCSDGYYRPAGVSPSNSSPCTP
CNCDSTGSTGPVCIKAEGIPGEVVGQCPCRDNVRGRACDECADGFFNLTAGCQSCHCNTD
GTIGGSVSCNENTGKCSCKLNVEGLRCDQC
Download sequence
Identical sequences XP_019863641.1.10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]