SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019898235.1.71217 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019898235.1.71217
Domain Number 1 Region: 217-395
Classification Level Classification E-value
Superfamily MIR domain 4.97e-42
Family MIR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1078-1168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000633
Family Trypanosoma sialidase, C-terminal domain 0.08
Further Details:      
 
Domain Number 3 Region: 3901-3960
Classification Level Classification E-value
Superfamily EF-hand 0.00000000187
Family Calmodulin-like 0.021
Further Details:      
 
Domain Number 4 Region: 659-802
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000293
Family SPRY domain 0.065
Further Details:      
 
Domain Number 5 Region: 434-548
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000000327
Family IP3 receptor type 1 binding core, domain 2 0.0086
Further Details:      
 
Domain Number 6 Region: 101-182
Classification Level Classification E-value
Superfamily MIR domain 0.0000235
Family MIR domain 0.021
Further Details:      
 
Domain Number 7 Region: 2015-2080
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000458
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019898235.1.71217
Sequence length 4827
Comment PREDICTED: ryanodine receptor 3 [Esox lucius]; AA=GCF_000721915.3; RF=representative genome; TAX=8010; STAX=8010; NAME=Esox lucius; AL=Chromosome; RT=Major
Sequence
MAEGGEGEDEIQFLRTDDEVVLQSVATIQKENRKFCLSVEGLGNRLCFLEPTSEAKYVPP
DLCICCFILEQSLSVRALQEMLAHTGPNEGAAQGGGHRTLLYGHAILLRHSFSGMYLTCL
KTSRSLTDKLSFDVGLQEDSIGESCWWTIHPASKQRSEGEKVRIGDDLILVSVSTERYLH
LSISNGSFQVDASFMQTLWNVQPTCSGSNVAVGFLCGGHVMRLCHGHDESLTIPGSKASE
MEQRIVNYEMGKGTSRARSLWRLEPLRIGWSGSHIRYGQAFRLRHLSTGHYLALTEDHGL
VLQDRGKSDTKSTAFCFRATKEKIEAGTKNRDMEGMGVAEIKYGDSVCFVMHVATGLWLS
YQAPDAKASRIGPLKRRACLHAEGHMDDGLTLQRCQHEEARAVRIIRNTTVLFSQFIRGL
DSIAGDKNVEVSLPDLDEVLQTLDDLIEYFKQPDSELEHEEKQTLLRSLIKRQDLFKEEG
MLTLLVKCIDRLNLYNSAAHFGEHAGEEAGAAWKNILNLLYELLASLIKGNRNNCTQFSK
NLDWLVSKLERLESSSGILEVLHCILIESPEALNIIQKAHIKSIISLLYKHGRNHKILDV
LCSLCVCNGVAVRANQNLICDHLLPKRDLLLQTRLVNDVQSMRPNIFLGMAEGSAQYRKW
YYELMIDQVDHFVTSEPSHLRVGWASSKGYAPYPGGGEGWGGNGVGDDLYSYSFDGLHLW
SGRVPRAVASINQHLLNSDDVVSCCLDLGAPSISFRINGQPVQGMFEDFNTDGFFFPVVS
FSAGVKVRFLLGGRHGDFKFLPPAGYSPCYEALLPKEKMSVEAVKDYKRDHGGVRDLLGT
TQLLSQASFIPTPVDTSQIVLPSHLENVRDRLAENIHELWGMNKIELGWSYGKVRDDNKR
QHPCLVDFTKLPETESNYNLQMSSETLKTLLALGCHVAQTNVNAVDDLKKVKLPKEYVMS
NGYKPTPLDLSEVKLTAGQEVLVDKLAENAHNVWAKDRIKQGWTYGIQQDVKSRRNPRLV
PYALLDERTKKSNRDSLREAIRTLVGYGYNIDPPDQEACHVVERQSIETIRFFRVEQTYA
VKTGKWYFEFEAVTGGDMRVGWARPGCRSDFDLGMDDQAFVFDGFKARRMHMGATSFGRS
WSPGDVVGCMISMEDKSMMFTLNGELLITNKGSELCFIDFETEDGFIPVCCITQSQVGRM
NLGKDASTFKYYTMCGLQEGFEPFAVNMNREVTMWFSKRLPTFVNIPKDHLHIEVTRIDG
TVDNPPCLKVTHKTFGTQQSNSDMLYCRLSMPVEFHARDVNAEESQKLSQPPKEDDYGSI
TTYFHSVRVFAGQDPASVWVGWVTPDYHYISKNFSLNKTRTVTVTLGDERGRVHESVRRS
NCYMVCAGDVASASHSSSRSNVDLEIGCFVNLATGLIAFTANGKELATTYEVESNTKLFP
AVFVRPTSPNLFQFEFVKIKNAMPLSSAIFKSELRNPVPQCPPRLDIQTMVSVLWSRMPN
HFLTVETARVSERHGWVVQCLEPLQMLAVHIPEENRCLDILELSEDEGLRAFHYHTLKLY
CALCALGNTRVAHALCSHLDQSQLLYTINNQYLSGMLREGFYDVLISIHLETAKDARLMM
NNEFIIPVTDETRSIKLFPDESKRHSLPGVGLSTSLKPRLNFSPLSFITTKKTQHLYSPH
IPLGILKDKAISMLTEAVQGGGSHIRDPVGGSVEFQFVPILKLIGTLLIMGVLTSEEVRL
ILLLIDPNVFGDPPEEEAKVEEAVAVGEKEDVSSNEEKAVEAGEEENKEVKPPVKGLLEK
TLPESVKRQMCELLHYFCDCELKQRIEAIVSFSDGFVSKLQFNQKFRYNELMLALNMSAA
VTAKKTKEFRSPPQEQINILLNFSAGEDCPCPEEIREELYSFHDELRLHCANLKELISQT
MASWAQECSIQDPELVRVMFSLLRRQYDGVGALLRALRKSYTISAASVQDCVNLLASLGQ
IRSLLAVRMGKEEEKLMIDGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGGDKSQ
EIAFPKMVASCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAS
SVMDNNSLALALEEPDLEKVVTYLAGCGLQSCAMLLAKGYPDIGWNPIEGERYLSFLRFA
VFCNGESVEENSNVVVKLLIRRPECFGPALRGEGGNGLLAAMLEAIKISEDPALDLPSTA
KAQPDGSGEDEEEEEVAHTGNAIMSFYSALIDLLGRCAPEMHLINKGKGEALRIRAILRS
LVPTTDLVGIISIPLKMPTVNKDGTVKEPDMSASFCPDHKAPMVLFLDRVYGVEDQTFLL
HLLEVGFLPDLRASASLDTDVLSTTETALAMNRYIGSAVLPLLTRCADQFAGTEHYATLI
DSTLHTIYRLSKGRSLTKAQRDSIEECLLAICKHLRPSMMASKLQSAYRDCDWHKHAIGP
DVPLLLANQRTVTVTGHKHAIGPDLLTEHYEQSWKYYCIPSGMGISGMASDDELLLTKKL
FWGIFDSLSAKRFDPDLFKTAMACLSAIAGAVPPDYVDASPSATLEKQVSVDAHGNFDPK
PINTANISLPEKLDYIANKFAEQSHIKWSSEKVTAGWKTGDVLDEEAKTHPLLKPYKSLS
EKEKESYRWPVKESLKSMLAMGWNIERTKEGEAMLIEKQIKMSESTQDNDNGFIPESPMD
LSNITLSRELQSMVEVVAENYHNIWAKKKKIELDGKGGGTHSLLVPYDTLTAKEKYRDRE
KAQDLFKFLQINGYTITRGVKDMEQDSSSMEKRFAYTFLKRLLKYVDSAQEFIAHLEAMA
TSGKTDKSPHDQQIKFFAKVLLPLIDTYFKNHSMYFLSTPSKNLSSSGYASNKEKEMATS
LFCKMAALVRHRISLFGSDTGIMVSCLLILAHSLDTRTVMKSGSELVKAGVRTFFENAAE
DLEKTLEMLKLGKFSHSRSQMKCLSQNISYATTALLPILTGLFEHITMHKFGVQLLVDDV
QLSCYRIVTCLYTLGTGKYIYVERHLPALGECLATLVGAMPAAFLEPDLNAHNPLSVFNT
KTPRERAILSMPDSVVEMCPEMPRLDGLLKDINDISESGARYTEMPQVIEVILPMLCTYL
SHWWEKGPENSAPDAACCTTVCSNHLSIILGNILKILNNNLGIDDAPWMKRIAVYSQPII
CKAAADLLKSHFLPTLEKLRKKTVKVAAEEELLKADIKGDTQEAELLILDEFAVLCRDLY
AFYPMLIRYVDNNRSRWLKRPNAQSNELFNMVAEIFILWCKSHNFKREEQNFVVQNEINN
LSFLTGESKTKMSKSGGDQDRKHKRRRGELYSVQTSLIVAALKKMLPIGLNMCTPGDQEL
ISLAKTRYSLKDTDDEVKDQLRANLHLRDKSDDLAVQWQMNLYKDVVVESDEPTEADNIV
DRVQSISAAIYHLEQVEQPLRIKKCILQKLLSKQRKRAVVACFRMAPLYNLPRHRSINLF
MLGYQRLWIEAEDYSFEERLVQDLAKTQMKIVEEEEEDEVEVQPDPLHQLILHFSHNALT
ERSFLEEDPLYIAYADMMAKSCAEDEEENEEEAKEKTFEEKEMEKQKILYQQARLHARGA
AEMVLQMISASKGRLGPMVTCTLKLGISILNGGNVLVQQKMLDYLKEKRDAGFFKSLSGL
MQSCSVLDLNAFERQNKAEGLGMVTEEGSIKSEQGTKVLTNDDFTKDLFRFLQLLCEGHN
GDFQNFLRTQTGNTTTVNIIISTVDYLLRLQESISDFYWYYSGKDIIDEHGQENFSKALA
VAKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKEL
MDLQKDMVVMMLSLLEGNVVNGTIGKQMVDTLVESSSNVEMILKFFDMFLKIKDLTTSDN
FREYDPDNKGVISKKEFQKSMENQKQYTQSEIEFLLSCAEADENDMFNYEEFVERFHEPA
KDIGFNVAVLLTNLSEHMPHDPRLATFLEPAESVLNYFEPYLGRIEIMGGGKRIERVYFE
ISESSRTQWEKPQVKESKRQFIFDVVNEGGESEKMEMFVNFCEDTIFEMQLASQISEPDV
VERPEEDEEEVHSFFEELAEEQEESELEASSAFNMACVSAKKKFSKFKQTLTFKNLKKKY
KKFKKLSIKEMIHGFFSFFWMIFTGFFKGIYSIIFGFFHLIWSSMFGGGLVEGAKNMKVT
DILGNMPDPTQFGIHGDVLETEKAEVGDSVSGGTDQAIVPVDKAEQDILMELINPAPKKG
EGLKHVDPGLGDMAESQTVEKKNLTSTFEKKKAATAAEVKESEPEKADTEKKEKEDKAMV
AELKEAVAEEKPVPKSRNGQAKEAPTSFFASFFVGLEVYQTKMLNTLARNFYNMRFLALF
VAFAINFILLFYRVTGDGSDNDEDDSWTSSDDEEEGDDEYFVLEESTGYMAPMLCFLALF
HTALSTLCLVGYYFLKVPLVVFKREKGIARKLEFDGLYITEQPSDDDITGQWDRLVINTP
SFPNNYWDKFIKRKVINKYGDMYGAVRIAELLGLDKSALDFDPTQETVAEEGSLVSWLSS
IDTKYHIWKMGVVLTDNSFLYLIWYATMSILGHFNNFFFAAHLLDIAMGFKTLRTILSSV
THNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEAAPDMKCDDMMTCYLFHLYAG
VRAGGGIGDELEDPAGDPYELWRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQV
KEDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYV
WKMYQERCWDFFPAGDCFRKQYEDLLG
Download sequence
Identical sequences XP_019898235.1.71217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]