SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019911443.1.71217 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019911443.1.71217
Domain Number 1 Region: 743-795
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000394
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 2 Region: 636-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000152
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 134-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000281
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 543-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000456
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 216-238,305-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000162
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 597-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000397
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number 7 Region: 678-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000862
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019911443.1.71217
Sequence length 889
Comment PREDICTED: zinc finger protein 709-like [Esox lucius]; AA=GCF_000721915.3; RF=representative genome; TAX=8010; STAX=8010; NAME=Esox lucius; AL=Chromosome; RT=Major
Sequence
MEPIDLETKDPPSSLSGYANGEIMTLEISDVSPDLLVLEVKDNHLPESIHRDLDMETAAD
FHEDAHDDEDDDDGHGFANVELQFFPCDACEASFTSGPELEQHFISSHSICDLASERGRL
KAKSVDIEGVAPLHTCTTCGKVFKYLTSFRKHEETHNVKPLYTCKTCGKEFKYLTSFTKH
QETHMPDQEERPRGRTMRRSIKAVGLSVNQKMKGLHSCRHCGKEFKYATSFIKHEKTHRM
TLTRKKQRNTTNSEMITGIRKEPTETHIQAFRKHSEDAEDQEASIVISSDDELATTAEQQ
KPDSKRSPPFPCQDCGKVFQFFKSYQKHLKRHAWAQGKSEGVLPNQKHKPEENIRCPVCG
RAFNKQTTLTKHQTVYHLNNNSVLNANTLTCCECDRHFEKADIFQKHKCFHLRKHVKAYI
EAGRVCQQWDVFHCQLCVLTLTSGMDFENHARVIHQDQYRKIVKAVGNVKKCIIKDTLRG
LQTRRDDNQTTGLGGTKTNSKRVGERAGDTTKQFICKDCGECFMYHASFNFCGKCLKVRK
NLKRYHCKECGQSFGRKDHLKRHSYSHSGSSFICSDCGIRFRDPGELRTHEKTHRVRNHV
CQLCEKRFEQQEELMLHSEVAHPGPDGYTCHHCGKTFSKVKNLGKHRMIHSYKTPHVCSH
CGKRFKRQEHLRRHESLHTNEKHHLCHCCGDAFVRKEDLNTHLSKKHTTLGRGNCLCKAC
GMTFKDRNSLRRHRYHSHTKTGKVYQCEECGLSFSRADHLKRHQNTHSSERPFSCSICYK
VFHRADNLKKHERNHRNKWLEYLSTRRRSKTLKMEGRVSESSKWKLGRSEASALLKLIQS
YSKQKHQTCYVCKKTFRGLYYLKRHRLLNCGGERNTMMDSFRYGKETVK
Download sequence
Identical sequences XP_019911442.1.71217 XP_019911443.1.71217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]