SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019914420.1.73221 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019914420.1.73221
Domain Number 1 Region: 555-600
Classification Level Classification E-value
Superfamily RING/U-box 3.28e-16
Family RING finger domain, C3HC4 0.0071
Further Details:      
 
Domain Number 2 Region: 366-463
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 5.23e-16
Family Cdc48 domain 2-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019914420.1.73221
Sequence length 602
Comment Uncharacterized protein PCOAH_00022790 [Plasmodium coatneyi]; AA=GCF_001680005.1; RF=representative genome; TAX=208452; STAX=208452; NAME=Plasmodium coatneyi; strain=Hackeri; AL=Chromosome; RT=Major
Sequence
MESCRRGESKHMHFLNNVNSKKKLNIVEKKGILEKVHILPIKKKGENADALYRKLQLLIN
EKCVLYEGFIIAANGEKEKVLREKNTQKNLKEGLTHDKEGPNENENNTTSTNLLEELCNA
KEGPCPNEDSCEVAHRKESNSHTHKKNSNQKDSKNTPNNDQICLHDKCNKEKSTDETSHL
KEKTDYYVVVNCIPSKGVLTRDTLIYTDGKYVDNLKKIHLIIIRDKYYKKYEKKLKKKFF
SLKKYILKKGNQFFNEAMSLIPFSFDHFSSKCNAEKGKSNSTFGGKKGDTVTPQRTTIKR
RSLVLEKILLTCLHPYFKKNRTKLFYSGKLLIINNFSFLVVKIDADVNVGFVDNSTEICL
NADTYDPFRNVHIVPLYDTLPTTYNYDIFADYIKPYIERHYLSLFSMHDTFFYKGVQFKI
MGIDPMNIKYGRGRITCNTFIYTDGAIKPTFFDVISNESINYIQCLPVEYKPYAVLNILQ
QLDADSLLRLFPSTNANLQESALNEQRILSHLDKYKYIYRNNTREDSQGGKMLLDVDVEE
HIDAKNKSGNFAYEQCAVCFEYFQNYDKCIKLACLHTYHWKCVKSWFRFNLTCPCCRREL
II
Download sequence
Identical sequences A0A1B1DYQ8
XP_019914420.1.73221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]