SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019920674.1.10878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019920674.1.10878
Domain Number 1 Region: 21-129,171-190,218-247
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000295
Family Ankyrin repeat 0.0043
Further Details:      
 
Domain Number 2 Region: 297-344
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000249
Family SOCS box-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019920674.1.10878
Sequence length 378
Comment PREDICTED: uncharacterized protein LOC105322959 [Crassostrea gigas]; AA=GCF_000297895.1; RF=representative genome; TAX=29159; STAX=29159; NAME=Crassostrea gigas; strain=05x7-T-G4-1.051#20; AL=Scaffold; RT=Major
Sequence
MGQILQYFSSEPPVCKTEEDLLNYAWKSVRLKCVDTLVKNEVTLKMRGMYGCSENNGIKV
LKEYTPLVIACMYRDLKLATKLIKLGADVNLCPQENRFASEEGVPPLYYATNARDAEMVK
LLFNSGADVNGLKGRPQCLNLQEPVNELYSIFDINRGTYSRSAKSCRRPQASLRDLVELY
LEAGAKLNTTRWGPCLFYGRGRVFKANRPTTLNIPGPYFKCDTAILLLQHGVDPNMYNLS
DVWFQFSGHNCFRSNNDCVQFSTLLETFLGAGYHLTSADINNRFIRENLKRIDVNVEEPV
SLKQMCRSAIRERLRKSSKDTTIFPAIDTLHIPSQLKDYLKLRDIINIPGPYFKCDTAIL
LLQHGVDPNITRQFEADV
Download sequence
Identical sequences XP_019920674.1.10878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]