SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019934930.1.63745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019934930.1.63745
Domain Number 1 Region: 460-624
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.29e-68
Family A middle domain of Talin 1 0.000000368
Further Details:      
 
Domain Number 2 Region: 723-859
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.06e-53
Family I/LWEQ domain 0.00000205
Further Details:      
 
Domain Number 3 Region: 2275-2464
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.02e-50
Family I/LWEQ domain 0.00014
Further Details:      
 
Domain Number 4 Region: 630-753
Classification Level Classification E-value
Superfamily I/LWEQ domain 9.03e-50
Family I/LWEQ domain 0.00000499
Further Details:      
 
Domain Number 5 Region: 1816-1950
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.35e-47
Family VBS domain 0.0000084
Further Details:      
 
Domain Number 6 Region: 1195-1331
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.8e-42
Family VBS domain 0.019
Further Details:      
 
Domain Number 7 Region: 198-312
Classification Level Classification E-value
Superfamily Second domain of FERM 1.13e-31
Family Second domain of FERM 0.00000125
Further Details:      
 
Domain Number 8 Region: 1043-1177
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.02e-27
Family VBS domain 0.0095
Further Details:      
 
Domain Number 9 Region: 1438-1514
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000903
Family I/LWEQ domain 0.0063
Further Details:      
 
Domain Number 10 Region: 313-374
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000156
Family Third domain of FERM 0.00013
Further Details:      
 
Domain Number 11 Region: 1672-1792
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000000408
Family alpha-catenin/vinculin 0.081
Further Details:      
 
Domain Number 12 Region: 1981-2109
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000157
Family VBS domain 0.014
Further Details:      
 
Domain Number 13 Region: 81-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000182
Family Ubiquitin-related 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019934930.1.63745
Sequence length 2520
Comment PREDICTED: talin-2 isoform X6 [Paralichthys olivaceus]; AA=GCF_001970005.1; RF=representative genome; TAX=8255; STAX=8255; NAME=Paralichthys olivaceus; breed=gynogenesis; AL=Scaffold; RT=Major
Sequence
MVALSLKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQSGQASDYGLFLSDDDPRK
GIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGAIKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLIQEVTEDKKEDGMGTLKKDRTLLLRDERKMEKLKAKLHTDDDLNWLDHS
RTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACE
FAGIQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGSEKKIFQEHKNCGEMTEIEAKV
KYVKLARSLQTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKDVVQDWPLTTV
KRWAASPKSFTLKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQFNRVGRVEHGSVALP
GIIRSGSIGGPDTFNVGTMPSAQQQITMGQMHRGHMPPLSLAQQALMGTINSSMQAVQQA
QSDLGHVDNLPPLGHDLASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGEPTETD
YTAVGCAITTISSNLTEMSKGVKLLAALMDDEVGSGHKLMGAARMLAGAVSDLLRSVEPA
AAEPRQTVLTAAGSIGQASGDLLRHMGEGETDEKFQDTLMNLAKAVANAAAMLVLKAKNV
AQVAEDTVLQNRVIAAATQCALSTSQLVACTKVVSPTISSPVCQEQLVEAGKLVDRSVET
CVKACRSASDDGELLKQVGAAAGVVSQSLSDLLQHVRHYASCGEPIGRYDQATDTIMNVT
ENIFTSMGDAGEMVRQARVLAQATSDLVNAMRSDAEAEVDVDNSKKLLAAAKLLADATAR
MVEAAKGAAAYPENEDQQQRLREAAEGLRVATNAAAQNAIKKKLVNRLEIAAKQAAAAAT
QTIAAAQNAAASNKNTVSHQQLVHSCKAVADSIPHLVQGMRSSQAQPEELGAQLALIMAS
QSFLQPGSKMVASTKSAVPTVADQAAAMQLGQCAKNLATCLAELRTATQKAHEACGPLEI
DSALKTVQTLKSELQDAKMSVIDAQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLTCAA
QGNEHYTGVAARETAQALRTLAQAARGVAASTKEPQAAAAMLDSAQCVMEGSAMLIHEAH
QALVHPGDAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDMALRSIGEASKKLLVDILPP
CSKTFQEAQTDLNHTAAELNHSAGEVVHSSRGTSGQLAAASGKFSQDFDEFLDAGIEMAG
HTQSKDDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAANAKNLLAVAARAVTESINQLI
TLCTQQAAGQKECDNALRELEAVRGLLDNPNEPVSELSYFDCIESVMENSKVLGESMAGI
SQHCKTGDVLAFGESVGVASKALCGLTEAAGQASYLVGVSDPNSQSGHEGLVDPIQFARA
HQAIQMACQNLVDPTSSPSQVLSAATIVAKHTSALCNACRLASSKTSNPVARRQFVQSAK
EVANTTANLVKTIKVNSPTDQNGLDGDFSEENRNRCRVATTPLLEAVENLSTFANNPEFA
SIPAQISNEGSAAQEPIVRSARSMLDSSTYLLETARSLVLNPKDPPTWSILAGHSRTVSD
SIKSLITSIRDKAPGQRECDYSIDNINKCIRDIEQASLAAVGQTLPCRDDISMEALQEQL
TSSVQEIGHLIDPVSTTARGEAAQLGHKVTQLASYFDPLIMASVGLASKLNDHQQQMTIL
DQTKTLSESALQMLYAAKEGGGNPKASHTHDAISEASQLMKEAVDDIMVTLNEAASEGGM
VGGMVESIAESMGRLDEGTPPEPEGSFVDYQTTMVKFSKAIAITAQEMMTKSVTCPEELG
GLASQVTVDYAQLAHQGRLAAATAEPEEVGFQIKTRVQELGHGCIYLVQKAGALQLSPTD
SFSKRELIECARAVTEKVSLVLSALQAGNKGTQACITAASAVSGIIADLDTTIMFASAGT
LSPENEESFADHRENILKTAKALVEDTKLLVAGAASSQEKLAQAAQSSAKTITQLTEVVK
LGATSMGSEDPETQVVLINAVRDVAKALAELIGATKCAAGKPADDSSMYQLKGAAKVMVT
NVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDVPDKSTTPEEFTRMTKGIT
IATAKAVAAGNSAQQEDVIATANLSRKAISDMLTTCKQAAFHHEVSEELRSRALQYGSEC
TSGYINLLEQVLQVLQKPTPEQKQQLAMHSKHVAACVTELVQTAEAMKDGGSECVDPEDP
TVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQILEAAKSIAAATSALVK
SASAAQRELVAQGKVGSNLANAVDDGQWSQGLISAARLVAAATSNLCEAANASVQGHASE
EKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDSLVKAAQKAAFDK
TEDDSVVVKTKFVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQQQYKFLPSELREDEG
Download sequence
Identical sequences XP_019934930.1.63745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]