SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019940068.1.63745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019940068.1.63745
Domain Number 1 Region: 457-592
Classification Level Classification E-value
Superfamily TIMP-like 1.73e-25
Family Netrin-like domain (NTR/C345C module) 0.022
Further Details:      
 
Domain Number 2 Region: 233-328
Classification Level Classification E-value
Superfamily Immunoglobulin 6.47e-21
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 411-464
Classification Level Classification E-value
Superfamily BPTI-like 2.55e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0034
Further Details:      
 
Domain Number 4 Region: 346-405
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000298
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.024
Further Details:      
 
Domain Number 5 Region: 148-200
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000638
Family Ovomucoid domain III-like 0.029
Further Details:      
 
Domain Number 6 Region: 58-107
Classification Level Classification E-value
Superfamily Elafin-like 0.000000968
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019940068.1.63745
Sequence length 594
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Paralichthys olivaceus]; AA=GCF_001970005.1; RF=representative genome; TAX=8255; STAX=8255; NAME=Paralichthys olivaceus; breed=gynogenesis; AL=Scaffold; RT=Major
Sequence
MYKIPLQLLEDRRPKETHCHNAHNSNSRGLGWICAYLLMLLLCELPDLSLCASVAEAKVE
HEGLCPNKLNSNLWVDAQSTCERECNVDEDCADFEKCCTNVCGLYSCVSARFSDGTSAQP
DGQGGGEGGDNQNSTATCEGFICSQQGATCDIWDGQPICKCQDRCEKEPNFTCASDGLTY
FNRCYMDAEACVRGVTLTVVACRFYLAGPHSSPLPQDTTVNPTPTSSQEDPLPPTLYSNP
HHQSIYVGGTVSFHCDVTGVPKPDVTWEKQSDRRERLVMRPDQMYGNVVITNIGQLVIYN
AQVWDTGIYTCIARNSAGVLRANFPLSVIRQGDDDFFEDPEMPMGRPFSPADCLAEVDLR
VCSGERHVDWYYDSKLGSCMAFSNGGCDDSRNRFETYEECKASCQREGMGICSLPAVQGP
CKSWEARWAWNSVMKECQAFAYGGCHGNANNFRTKKECEANCPQPKRKPCKTCRVKGKMV
PSLCRSDFAIVGRLTELVEDLDSGLARFSLDEVLRDEKMGLTFFNTKHLEVTIAKIDWSC
PCPNITMEENPLLVMGVVQDGIAIIQSDSYVRAITERRLKKLREVLGKKTCGSS
Download sequence
Identical sequences XP_019940068.1.63745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]