SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019940275.1.63745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019940275.1.63745
Domain Number 1 Region: 204-381
Classification Level Classification E-value
Superfamily MIR domain 3.14e-46
Family MIR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1064-1155
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000116
Family SPRY domain 0.08
Further Details:      
 
Domain Number 3 Region: 633-787
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000034
Family SPRY domain 0.058
Further Details:      
 
Domain Number 4 Region: 3908-3986
Classification Level Classification E-value
Superfamily EF-hand 0.000000342
Family Calmodulin-like 0.022
Further Details:      
 
Domain Number 5 Region: 2061-2126
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000366
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 
Domain Number 6 Region: 88-169
Classification Level Classification E-value
Superfamily MIR domain 0.0000458
Family MIR domain 0.027
Further Details:      
 
Domain Number 7 Region: 423-533
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000772
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019940275.1.63745
Sequence length 4868
Comment PREDICTED: ryanodine receptor 3-like [Paralichthys olivaceus]; AA=GCF_001970005.1; RF=representative genome; TAX=8255; STAX=8255; NAME=Paralichthys olivaceus; breed=gynogenesis; AL=Scaffold; RT=Major
Sequence
MKDDEVVLQCVACIQKENRKFCLAAEGLGNRLCYLEPTSEAKYVPPDLCICTFVLEQSLS
VRALQEMLAKSGQNSEGAAQSGGHKTLLYGHAILLRHSFSSMYLACLKTSRSQTDKLSFD
VGLQEDSTGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLSISNGNIQVDAS
FMQTLWNVHPICSGSNIEEGYLLGGHVMRLFHGHDEVVTIPGSDQSEERQRIVNYETGKA
GAKARSLWRMEPLRISWSGSHIRWGQPFRLRHLTTGHYLALTDDRGLVLQDREKSDTVAT
AFCFRASKEKLEQSPKRDIEGMGVAEIKYGDSLCYITHVATGLWLSYQAPDVKSARLGPL
KRRACLHSEGHMDDGLTLQRCQHEESRAARIIRNTTLLFNRFIRDLDCLGVKNRALVALP
VEEVLQTLNDLITYFQLPDAELEHEERQIKLRSLKNRQNLFKQEGMLTLVSNCIDRLNVY
NSAAHFGECAGSEAGAAWKDILNLLYELLAALIRGNRNNCTQFSNNLDWLVSKLERLESS
SGILEVLHCILIESPEALNIIQRGHIKSIISLLYKHGRNHKILDVLCSLCVCNGVAVRTN
QNLICDHLLPKRDLLLQTQLVNDVQSMRPNIFLGVSEGSAQYKKWYYELMIDQVDHFVTS
EPSHLRVGWANTKGYAPYPGGGEGWGGNGVGDDLYSFGFDGLHLWSGRIPRAVASMNQHI
LTSEDVVSCCLDLGAPSISFRINGQPVQGMFENFNTDGLFFPVVSFSAGVKVRFLLGGRH
GDFKFLPPSSYAPCYEALLPKEKMKVEPVKEYKRDADGVRDLLGTTQFMSQASFIPTPVE
TSQIVMPPHLEKVRDKLAENIHELWGMNKIELGWSYGKIRDDNKRQHPCLVDFSKLPDTE
KNYNLQMSTETLKTLLALGCRVVQVNPNAEDSLKKIKLPKNYMMSNGYKPSPLDLSDIKL
APGQELLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSKRNPRLVLYVLLDERTKKSNRD
SLREAIRTLIGYGYNIDPSDQEGGQVAERLSIDKVRFFRVERTYSVKMGKWYFEFEAVTG
GDMRVGWARPGCKPDVELGTDELAFVFDGFRGHCLNMGSRLFGRCWHAGDVVGCMINMED
KSMIFTLNGEILITTKGSELCFTDFETEDGFIPVCSLGLAQVGRMNLGKDASTFKYYTVC
GLQEGFEPFAVNMNREVTMWFSKRLPTFVNVPRDHNHIAVTRIDGTIDSPPCLKVTHKTF
GTQNSNADMVFCRLSMPVEFHSFFKSSPVIDMNGLHEDDALKVKHRYPLRSVRHSEESRR
VDYSTITMYHHSVRVFAGQDPAGVWVGWVTPDYHYYSNNFNLSKNRSVTVTLGDERGRVH
ESVKRSNCYMVWGGDVTSAAHTSSRSNVDLEVGCLIDLATGLVTFTVNGKEISTSYQVEP
NTKLFPAVFVRPTSPNLFQFELAKIKNSMPLSSAIFKSEHKNPVPQCPPRLDVQTINAVL
WSRMPNIFLKVETARVNERHGWVVQCVEPLQMMAVHIPEENRCVDIMELSEQEDMRMFHY
HTLKLYCALCALGNTRVAHALCSHLDQSQLLYTIDNQYLSGMLREGFYNVLISIHLETAK
EARLMMKDEFIIPVTAETRSIRLFSDASKKHLPPGVGLSTSLKPRLNFAPPCFISTKREQ
HLYSPQIPLDALKEKAISMLTEAVQGGGHHIRDPVGGGVEYQFVPILKLVSTLLTMGVLV
SEDVHKILLLIDPNVFRETHEEGATGATDKEGLTGAEEKAVEAGEEEAAKEAKQPIKGLL
EKRLPEPVKRQMCELLHYFCDCELKHRIEAIVSFSDSFVSKLQYNQKFRYNELMLALNMS
AAVTAKKTKEFRSPPQEQINMLLTFSMGEDCPCPTDIQEELYVFHNQLQLHCGIPMEEDE
DEQDTSIKGRLLMLVCKIKGQSHKAEEPTEKEQAAPSNLKELISQTMVSWAQECHIQDPE
LVRKMFSLLRRQYDSIGELLRAMRKAYTISAVSVQDTINLLASLGQIRSLLSVRMGKEEE
KLMIDGLGDIMNNKVFYQHPNLMRILGMHETVMEVMVNVLGGDKSQEIAFPKMVASCCRF
LCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAASSVMDNNGLALALEE
PDLDKVVTYLAGCGLQSCPMLLAKGYPDIGWNPIEGERYLSFLRFAVFVNGESVEENSSV
VVKLLIRRPECFGPALRGEGGNGLLAAMKEAIKISETPALDLPGSVQGVSSDVSADGDDE
EEVVHMGNAIMSFYSALIDLLGRCAPEMHLINKGKGEALRIRAILRSLVPTEDLVGIISI
PLKMPIINKDVSVTEPDMSACFCPDHKAPMVLFLDRVYGIEDQSFLLHLLEVGFLLDLKA
AATLDTEGLCTTETALAMNRYIGSAMLPLLTRCAPLFAGTEHRASLIDSTLHTIYRLSKG
RSLTKAQRDAIEECLLAVCKHLRPSMLQQLLRRLVFDVPLLTEYCKMPLRLLTNHYEQNW
KYYCLPSGWGSYGTASEDELLLTKKIFWGVFDSLSQKKYDPELFKMAMPCLSAIAGALPP
DYVDASISTTVEKPVSVDAQGNFDPKAINTANIALPEKLEHFANKYAEHSHEKWSAEKVL
LGWKYGDCVDEKAKTHPQLRTYKALTEKEKEIYRWPIRESLKSMLAMSWSIDRTKDGESM
SQQRENEKMRKISQTSQANGFNPSPIDTSTVVLSRELQGMVEIVAENYHNIWAKKKKSDL
GSRGGGTHPLLVPYDTLTAKEKARDREKAQDLFRFLQINGYSITRGLKDLEQDSSSMEKR
FAYRFLKKLLKYVDSAQEFIAHLEAMAASGKTDRSPHEQEIKFFAKVLLPLIDQYFKNHS
LYFLSSPSKNLSSSGYASNKEKEMVTSLFCKLAALVRHRISLFGSDSTTMVSCLHILAHT
LDTRTVMKSGSEMVRVGLRTFFENAAEDLEKTFENLKLGKFTHSRSQMKGVSQNINYTTV
ALLPILTALFEHITQHHFGVDLLLDDVQVSCYRILTSLYALGTGKNIYVERQLPALGQCL
ATLAGAMPVAFLEPMLNTYNPCSVFNTKSARERAILGIPDSVEDMCPGMPRLDGLIKDIN
DMAESGARYTEMPHVIEVVLPMLCNYLSYWWERGPENQPASGGSVCCTTVTSEHLSLILG
NILKILNNNLGIDEASWMKRIAVYVQPIISKARADLLKSHFLPTLEKLKKKTVKVVAEEE
LLKADSKGDTQEAELLILDEFAILCRDLYAFYPMLIRYVDNNRSRWLKEPDADSNELFRM
VAEIFILWCKSHNFKREEQNFVVQNEINNLSFLTGDNKTKMSKSGGQDQERKHKKRRGEF
YSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKTRYLLKDTDDEVKDHIHQNLHLREK
SEDPAVRWQLNLYKDIVMRSEGPPDPERVVDRIQRISAAVFNLEQVEQPLRSKKCVWQKL
LSKQRKRAVVACFRMAPLYNLPRHRSINLFLLAYQRIWIETEEYSFEEKLVQDLAKTQPI
VEEEEEEEVRKQPDPLHQLILHFSHNALTECSSLEEDPLYIAYADMMAKSCAEGEEEEDE
EGKEKTFEEKEMEKQKMLYQQARLHDRGAAEMVLQMISASKGRLGAMVTFTLKLGISILN
GGNTVVQQKMLDYLKEKRDVGFFKSLSGLMMSCSVLDLNAFERQNKAEGLGMVTEEGSIN
VSERGSKVLQNDEFTQDLFRFLQLLCEGHNNDFQNFLRTQTGNTTTVNIIISTVDYLLRL
QESISDFYWYYSGKDIIDEAGQRNFSKALAVAKQVFNSLTEYIQGPCIGNQQSLAHSRLW
DAVVGFLHVFANMQMKLSQDSSQIELLKELLDLQKDMIVMMLSLLEGNVVNGTIGKQMVD
TLVESSSNVEMILKFFDMFLKLKDLTTSDSFREYDPESKGIISKKDFQKSMENQKQYSQS
EIEFLLSCAEADENDMFNYEQFVERFHEPAKDIGFNVAVLLTNLSEHMPHDARLSTFLDL
AESVLSYFEPYLGRIEIMGGAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGG
ESEKMELFVNFCEDTIFEMQLASQISEPDPVERPEEDEEDKQSVMENQEEEEEEESIMLE
SSSAFTIACISLRKSLCHFRQMLTLKSMRRQYRKFKKMSVKEMVRGFFSFFWMIITGLFH
LVYSLIWGFFHILWTTMFGGGLVEGAKNMKVTDILGNMPDPTQFGIHGDVLETEKMEASG
ASALAELGQMAQGEAAEADLMAELLYIQPKKEGKHGAEPGLGDVSEVVVGDAPSIASAVR
QKKAQMAAKKRAVNGDYKSDSEKGDSEDGEKKDHDKSKDEGPPEHSAGEKKAPKKRLGQR
KEPPEAFMASFFAGLEIYQTKMLNYLARNFYNLRFLALFVAFAINFILLFYKVTGDYSDD
EDPWNGQGRAGEEEDEGAIEYFVLQESTGYMAPTLRCLAILHTIISFLCVVGYYYLKVPL
VVFKREKEIARKLEFAGLYITEQPSDDDIKGQWDRLVINTPSFPNNYWDKFVKRKVIKKY
GDLYGAERIAELLGLDKSALDFNPTEETVAKEASLVSWLSSIDTKYHVWKLGVVFTDNSF
LYLVWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVY
LYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPY
ELYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFD
TTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERLWDFFPAGDCFR
KQYEDHLG
Download sequence
Identical sequences XP_019940275.1.63745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]