SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019951851.1.63745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019951851.1.63745
Domain Number 1 Region: 29-514
Classification Level Classification E-value
Superfamily Sema domain 9.29e-101
Family Sema domain 0.00063
Further Details:      
 
Domain Number 2 Region: 1382-1506,1672-1856
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-34
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 859-950
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000204
Family Other IPT/TIG domains 0.029
Further Details:      
 
Domain Number 4 Region: 1042-1126
Classification Level Classification E-value
Superfamily E set domains 0.0000000000153
Family E-set domains of sugar-utilizing enzymes 0.03
Further Details:      
 
Domain Number 5 Region: 950-1023
Classification Level Classification E-value
Superfamily E set domains 0.0000000000344
Family Other IPT/TIG domains 0.055
Further Details:      
 
Domain Number 6 Region: 512-558
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000436
Family Plexin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019951851.1.63745
Sequence length 1896
Comment PREDICTED: plexin-D1 [Paralichthys olivaceus]; AA=GCF_001970005.1; RF=representative genome; TAX=8255; STAX=8255; NAME=Paralichthys olivaceus; breed=gynogenesis; AL=Scaffold; RT=Major
Sequence
MPSSIEIAVLLLGVLALETRRSASALHIQQAFSSPNHTNNFVVDPGSRRVYLATVNTVYQ
LNGNLSVEVEKRTGPVQDNLLCHAPQLPQAPCEHPKSLTDNFNKLLKLDREQGVVVVCGS
VYQGFCELRKMENISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNTKDLPRLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNEANLGHKESQPNSILARICLDTDNPRKSSGPESR
KLTESYIQMPLQCGYNGNIYKRLLSLYPAEIHTEDAQDAEPYLFGVFSRQTDRKSALCAF
KFGDIEEEIRQGRRNCSNSPSSDVQVLDSVIQGSGAACIQKGNLVLQPEQLDCGAAHLQH
PLALRRPLRSIPLFEYPGLSSVSVDNVHDHTVVFLGTSNGRLRKLTLLANMTLANQWTLK
LPASEAVHHIMTFDPNDRNFLYLMTSHHMLRVKVADCDQWKSCSSCLGASDAHCGWCTLE
NRCTIQKECAQGLLARTWISMGEGPQQCPSMTLTPPEISISADIKNVGILINGSVPDLVG
SRVECEYGPGVETAATVHLDSGSAQIQTCPLLPRENYQPILPGTDHLTVSVAIKVNGTSV
VSGSFIIYDCERTGAIHPKMSCMSCLSTRWKCYWDHEKHLCVSAKDNSKHNLLENAASCP
SLVISEVPPTPSEMAQDFTISLSNIQEGEKLDCDFGTEQQYEATWLNSSTVKCSGVTLST
NQRSQVYHLNLRRREFITEQGEDVFIDSPQPMKVEVYNCGVGSSDCSQCWGREDQGHLCG
WCENGCRPRDDCQQISDQCPAPEIHKISPLRGPVEGGTFLTIEGRNLGRRAGAVKVYIGD
VPCSLLPEFYSVSVKLVCVTGWSEQDKKDIVRVDVDQSGMGASKESFSYLVPKLLSLEPR
KGSRAGGTRVTLRGEHLDIGSQVRVKVNNTLECTIKEKTDETIECTMPPASQVYTDLVTV
CVEFENLSCQNTELSATYTYEKNPTISYIHPKKSYLSGGRTITVTGQGFNLVQGVTMQVL
GIGEKPCTVLSPSMITCLSLASSQSQQTTVQFFLNGVLYTGDSPFYPDEEEGEPHKGHFL
LEYVEDPQFFTPNKEKLIKHHPGEPLTLIINKGPSDLELEPEEYSVMIGPYPCNISFHND
QLFHCTINGLLSSSESELLVTVQVGNFRHTIAKVQLGGSELAIVVSIVVCCVLLLLCTVA
LVVYCTKSRRAERYWQKTLLQMEEMESQIRDEIRKGFAELQTDMTDLTKELNRSQGIPFL
EYKQFVTRTFFPKMCSDYEKSLVQPVYENDALGPRVLPETHPLLQDWKATNTTRPNVEEG
ITLFSTLLNNKHFLVTFVHALEQQKDFAIRDRCSLASLLTIALHGKLEYYTSIMKDLLVD
LIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKGS
IDAITGKARYTLNEEWLLRENIEATPQNINVSFQGCGMDSLSVRVMNTDTICQVKEKILE
AFYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYLIPEGAS
LAMSMKDKKDNTLGRVKDLDTEKYVHLVLPHDDLMETKRSHRQSHRKKVLPEIYLTRLLS
TKGTLQKFLDDLFQAILSIPPESPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPL
RFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIP
EYKKRVQLYYQQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRNQVV
SALESNPTAKRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_019951851.1.63745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]