SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019953023.1.63745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019953023.1.63745
Domain Number 1 Region: 218-395
Classification Level Classification E-value
Superfamily MIR domain 4.97e-46
Family MIR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1077-1204
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000844
Family SPRY domain 0.058
Further Details:      
 
Domain Number 3 Region: 658-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000404
Family SPRY domain 0.056
Further Details:      
 
Domain Number 4 Region: 3551-3575,3679-3739
Classification Level Classification E-value
Superfamily EF-hand 0.0000000427
Family Calmodulin-like 0.031
Further Details:      
 
Domain Number 5 Region: 435-547
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000536
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 6 Region: 102-183
Classification Level Classification E-value
Superfamily MIR domain 0.0000327
Family MIR domain 0.021
Further Details:      
 
Domain Number 7 Region: 1821-1889
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000353
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019953023.1.63745
Sequence length 4606
Comment PREDICTED: ryanodine receptor 3 [Paralichthys olivaceus]; AA=GCF_001970005.1; RF=representative genome; TAX=8255; STAX=8255; NAME=Paralichthys olivaceus; breed=gynogenesis; AL=Scaffold; RT=Major
Sequence
MAEGGEGEDEIQFLRTDDEVVLQSVATIQKEHCKFCLAAEGLGNRLCYLESTSEAKYVPP
DLCICNFVLEQSLSVRALQEMLAKTGQNSEGAGQGGGHRTLLYGHAILLRHSFSGMYLTC
LKTSRSQTDKLSFDVGLQEDSIGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSTERYL
HLSISNGNIQVDASFMQTLWNIQPTCSSSNVAVGYLTGGHVMRLCHGHDESLTIPGADKN
EEEQRIVNYEAGKGASRARSLWRLEPLRISWSGSHIRWGQAFRLRHLSTGHYLALTEDRG
LVLQDRVKSDTKSTAFCFRASKEKGDSGPKRDIEGMGVPEIKYGDSVCFIMHVQTGLWLS
YLAPDAKSSRLGPLKRRACLHSEGHMDDGLILQRCQHEEFRAARIIRNTTFLFVNFIKAL
DSTANGESMAVAGYVEEVLQTLNDLIEYFKQPDLELEHEEKQCLLRSLIKRQDLFKEEGM
LALLSKCIDRMNLYNSAAHFGEMAGEEAGAAWKDILNLLYELLASLIRGNRNNCTQFSRN
LDWLVSKLERLESSSGILEVLHCILVESPEALNIIQRGHIKSIISLLYKHGRNHKILDVL
CSLCVCNGVAVRANQNLICDNLLPKRDLLLQTRLVNDVQSMRPNIFLGMAEGSAQYKKWY
FELVIDQVDHFVTGEPTHLRVGWANTKGYAPYPGGGEGWGGNGVGDDLYSYSFDGLHLWS
GRIPRAVASINQHLLNSDDVVSCCLDLGAPSMSFRINGQPVQGMFEDFNTDGLFFPVVSF
SAGVKVRFLLGGRHGDFKFLPPAGYSPCYEALLPKEKMHVEPVKEYKRDHEGIRDLLGTT
KFLSQASFIPTPVDTTQVVLPPHLDNVRDKLAENIHELWGMNKIELGWTYGKVRDDNKRQ
HPCLVDFTKLPETERNYNLQMSSETLKTLLALGCHVAQVNVNAEDDLKKIKLPKDYMMSN
GYKPAPLDLSDVKLTAGQEVLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSRRNPRLVP
YALLDERTKKSNRDSLREAIRTVVGYGYDIDPPDQEVVHVLDNQSIETIRFFRVEQTYAV
KTGRWYFEFEALSGGDMRVGWARPGCRPDVELGTDNQAFVFDGYRVNLTLCKMTNNIVQR
SNCYMVCGADAVAPSSSSRTSSDLEIGCLIDLATGLVSFTANGKELPTTYQVEPNTKLFP
AVFVRPTSANLFQFEFVKIKDAMPLSSAIFKSEHRNPVPQCPPRLDVQTIVAVLWSRMPN
TFLSVETARVSERHGWVVQCLEPLQIMAVHIPEENRCLDILELSEHEDLRKFHYHTLKLY
CALCALGNTRVAHALCSHMDQSQLLYTIDNQYLSGMLREGFYNVLISIHLETAKEARLMM
NNEFIIPVTDETRSIKLFPDESKRHSLPGVGLSTSLKPRVNFSSVGIIDTKQHQYLYSPQ
IPLGILKEKAISMLTEAVQGGGTHIRDPVGGSVKYHFVPILKLIGTLLIMGVLTSEEVRL
ILLLIDPNVFGESKEGEEGKADEVTAAGEKEEVSKNEEKAVEAGEEETKESKPPAKGLLE
KSLPEPVKRQMCELLHYFCDCELKHRIEAIVSFSDSFVSKLQFNQKFRYNELMLALNMSA
AVTAKKTKEFRSPPQEQINILLNFTAGEDCPCPEEIQEELNSFHEELRLHCGIPVEEEEE
EQDTSIKGRLLALLYKIKGPPQKTEEEPTETEQPPPTNLKELISQTITSWAQESHIQDPE
LVRVMFSLLRRQYDGIGELLRAMKKSYTISAASVQDAINLLVSLGQIRSLLSVRMGKEEE
KLMIDGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGGDKSQEIAFPKMVASCCRF
LCYFCRISRQNQKAMFDHLSYLLENSSVGLASEAMRGSTPLDVAASSVMDNNGLALALEE
PDLEKVVMYLAGCGLQSCAMLLAKGYPDLGWNPIEGERYLSFLRFAVFCNGESVEENANV
VVKLLIRRPECFGPALRGEGGQGLLAAMKEAIKIAEDPALDLPKTPVGVTTGSGEEEGEI
IHMGNAIMSFYSALIDLLGRCAPEMHLINAGKGEALRIRAILRSLVPTTDLVGVISIPLK
MPVVNKDGTVTEPDMSACFCPDHKAPMVLFLDRVYGIEDQSFLLQMLEVGFLPDLRASAS
LDTEVLSTTETALAMNRYIGSALLPLLTRCAALFASTDHYAQLIDSTLQTIYRLSKGRSL
TKAQRDAIEDCLLAICKHLRPSMMQQLLRRLVFDVPMLTEYCKIPLRLMTNHYEQNWKYY
CLPTGMGSSGTASEEELLLTKKLFWGIFDSLSQKKYDADLFKMAMSCLCAIAGALPPDFV
DASLGATLEKQASVDAQGNFDPKPINTVNISLPEKLEYIANKYAEHSHDKWSSEKVSAGW
KHGDNMDEQNKTHPLLKAYKALSEKERETYRWPVRESLKSMLAMGWNVERTKEGEAIFQQ
RESEKQRKISESQVNGFSPAVMDLHNVTLSRELQGMVEVVAENYHNIWAKKKKTELVSKG
GGTHPLLVPYDTLTAKEKYRDREKAQELFKFLQISGYAITRGLKDMEQESSSMEKRFSFK
FLKRMLNYIDSAQEFIAHLEAMATSGKTDKSPHDQEIKFFAKVLLPLADQTFKNHCLYFL
STPSKNMSSCGCASNKEKEMVTSLFCKLAALVRHRISLFGSDSAMMVSCLHIITHSLDTR
TVMKSGSELVKAGFKTFFENAAEDLEKLLEMLKLGKFMQSRAQMKSVSQSINYVTVALLP
ILTAVFEHIRTHEFGVDLLLDDVQLSCYRILTCFYSLGTGKNPFMERHLPALGESLATLV
GAMPVAFLEPHLNAHNPLSVFNTKTPRERAILSMPDTVVEMCPEMPHLERLLKDVNDVSE
SGARYCDMPQVIEVILPMLCNYLSYWWEKGPENSPPDALCCTMVTSEHLSIILGNILRIL
NNNLGIDDAPWMKRIAVYSQPIICKAGADLLRTHFLPTLDKLKKKTVKVVAEEELLKADS
KGDNQEAELLILDEFAVLCRDLYAFYPMLIRYVDINRCRWLKEPDAYSTELFRMVAEIFI
LWCKSHNFKREEQNYVVQNEINNLGFLTEEGKTKMSKSGGDQERKHKRRRGEYYSIQTSL
IVAALKKMLPIGLNMCTPGDQELISLAKIRYSLRDTDDEVKEHLRQNLHLQDKSDDPAVQ
WQLDLYKDVVVKSEEPANPEHSVNRVQSISAAVFHLEQVEQPLRNKKCVWQKLLSKQRKR
AVVACFRMAPLYNLPRHRAINFFIPAYQRLWIEAEEYSFEEKLVQDLAKTPMKIVEEEEE
EVAEIQPDPLHQLILHFSHNALTERSHLEQDPLYIAYADMMAKSCAEDEEEEEEEGKEKT
FEEKEMEKQKILYQQARLHARGAAEMVLQMISASKGRLGPMVTCTLKLGISILNGGNVRV
QQKMLDYLKEKRDAGFFKSLSGLMQSCSVLDLNAFERQNKAEGLGMVTDEGSIHTERGSK
VLQNDEFTKDLFRFLQLLCEGHNGDFQNFLRTQTGNTTTVNIIISTVDYLLRLQESISDF
YWYYSGKEVIDETGKVNFSQALSVAKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFL
HVFANMQMKLSQDASQIELLKELMDLQKDMVVMLLSLLEGNVVNGTIGKQMVDTLMESSS
NVEMILKFFDMFLKLKDLTTSENFREYDPECKGIISKKEFQKSMESQKQYSQSEIDFLLS
CAEADENDMFNYKEFVERFHEPAKDIGFNVAVLLTNLSEHMPHDSRLATFLDLAESVLSY
FEPYLGRIEIMGSAKRIERVYFEISESSREQWEKPQVKESKRQFIFDVVNEGTESEKMEM
FVNFCEDTIFEMQLASQISEPDVVEQPEEEEEEEVHNILEELAGEEGGASESASAFSTAC
CSVKKKLANVRQIFSFKNVRKQFKKIKKLSIREIITGFFSFFWMLFTGFFKGIYSLVFGF
FHLIWSSMFGGGLVEGAKNIKVTDILGNMPDPTQFGIHGDVVEGEKVEAVELSGSLDTAM
APAGDIAEVDMMLEMLSAPKREGGKHVEPGLGDVSELSAEISSTEQKKKAAAKPVETPES
EPEKADTEKEDKPKEEEAKEPVTEEKPKTRSSQPKEAAPAFMSSIFAVLDIYLTKMLNYL
ARNFYNLRFLALFVCFAINFILLFYKVTAEAEEEVDDETTWGGDEEEGDDENTLFDMDEF
VLQESTGYMLPTLRFLAIFHTVISLVCLVGYYYLKVPLVVFKREKEIARKLEFDGLYITE
QPSDDDIKGQWDRLVINTPSFPSNYWDKFIKRKVINKYGDMYGAERIAELLGLDKSALDF
DPTVEAVEKEASLVSWLSSIDTKYHIWKMGVVLTDNSFLYLIWYTTMSIFGHFNNFFFAA
HLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDE
PDMKCDDMMTCYLFHMYVGVRAGGGIGDELEDPAGDPYELYRILFDITFFFFVIVILLAI
IQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDRTPHGFETHTLQEHNLANYLFF
LMYLINKDETEHTGQESYVWKMYQERCWDFFPTGDCFRKQYEDQLG
Download sequence
Identical sequences XP_019953023.1.63745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]