SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019964070.1.63745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019964070.1.63745
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000746
Family Ankyrin repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 221-267
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000798
Family SOCS box-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019964070.1.63745
Sequence length 297
Comment PREDICTED: ankyrin repeat and SOCS box protein 3-like, partial [Paralichthys olivaceus]; AA=GCF_001970005.1; RF=representative genome; TAX=8255; STAX=8255; NAME=Paralichthys olivaceus; breed=gynogenesis; AL=Scaffold; RT=Major
Sequence
SSVLRRLIAVTDRVCDRDDNMVSPLYVAIHNHQDKCVELLLREGYSPNAQDCTRSLGLSS
PLSFALCHSSTKPYSESVRLLVAAGVRLVEETWIHALATDKTDLLELILEHRLIPRPDTL
TQCCSVSHHPGKTVLTLQELKELLCVALSQVRFAACWLPLLLKAGLEPSLLLQPHMLEHA
DTEALNYFLQFINWSTLSAPLKQILIQRKAGKTWEPCADFDSIPHLSHICRLKVRAVLGP
DRLMRTSAVEQLPVPSLLHSFLQFRDVQEASFSHLPPSPLLDRIWVFHGAHQHRHVL
Download sequence
Identical sequences XP_019964070.1.63745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]