SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019969087.1.63745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019969087.1.63745
Domain Number 1 Region: 200-344
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.35e-62
Family A middle domain of Talin 1 0.000000304
Further Details:      
 
Domain Number 2 Region: 21-111
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-26
Family Third domain of FERM 0.00000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019969087.1.63745
Sequence length 344
Comment PREDICTED: talin-1-like, partial [Paralichthys olivaceus]; AA=GCF_001970005.1; RF=representative genome; TAX=8255; STAX=8255; NAME=Paralichthys olivaceus; breed=gynogenesis; AL=Scaffold; RT=Major
Sequence
MTEIEAKVSYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVI
QEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDH
FGLEGDEESTMLEDSVSPKKSTVLQQQFNKVGKVETGSVALPAIMRSGAGGPESFQMGSM
PQAKQHITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQASLDDFDTLPPLGTDAAS
QAWRKNKMDESKHEIHSQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMS
KGVKLLAALMEDEGANGQQLLGAAKNLACAVSDMLKTAQPANTE
Download sequence
Identical sequences XP_019969087.1.63745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]