SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019970915.1.2076 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019970915.1.2076
Domain Number 1 Region: 418-721
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-52
Family Duffy binding domain 0.000023
Further Details:      
 
Domain Number 2 Region: 107-395
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-48
Family Duffy binding domain 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019970915.1.2076
Sequence length 931
Comment erythrocyte binding antigen-181, partial [Plasmodium reichenowi]; AA=GCF_001601855.1; RF=representative genome; TAX=5854; STAX=5854; NAME=Plasmodium reichenowi; strain=SY57; AL=Chromosome; RT=Major
Sequence
MKGKMNMCLFFFYSLLYLILCAYVLGIGEEELKERPQGLNDKNNDNYNNNSKDLMSFANE
VVRFMENEKDVEEDKNVNIISGPVENTLNRYTGSSFLNIKKYGRKGEYLNRSSFFQRSYV
NGCQEKRKSHTWVCGNEGNDNICIPDRRVQLCITSLQDIKNSGSEKNDRELLKNKVFDSA
MYEADLLWNKYGFRGFDDFCDDVKNSYLDYKDVIFGTDLDKNNISKIVEEALKRFFKKDS
SILNPHAWWQRYGTRLWKYMIKPYEHLGCKKPDEGEPQINRWLKEWGKYNCKLLKEKEKS
LIKECAVNKRKTDCSRKCNNECYTYRNFINRQKYEINKLGKNYVKVIRYNIFNRKIIPPN
NALDFIKLNCSECNDVNFKTLFEFEYGKYEEKCMCQSYIDLKIQFKNHGICLFNAQTDTV
SSDKRFCVEKKESKPWQCDKNSFEKVHAEGVCVSPRRQAFCLGNLSYLLSDDIYKVHNSQ
LLIEILMASKQEGKFLWKKHGITFYNNYACKYINDSYADYKDIVIGTDLWNDKNSIKAQN
NLNAIFERNFGYKVGRNKLFKTIKDLRTVWWILNRDNIWESMKCGISDVDPRGYSCVRMN
ELENMPQFFRWFSQWAHFFCKEKEYWELKLNDKCKDTKGNSLCKEKTCQNVCTDMNYWTY
TRKLAYEIQSLKYNKERNLYSFSKDKNVSIFLKENTKNCYNIDFTKIFDQLDKLFKERCP
CMDTKRLEVKNKEMLSIEANSEEEEELQGNNNSVSVISGNEGTNSDTKVIVKDKNEKQQE
KEAKQTTGSLTVQTNEDSDSKKGKSTATDTKNSFEKLEVQKDATNGETIKEEHPELPQSP
ENSQTQEQEKSESDQPRTGQETGEQNEISSGQEQNEPSSSTEVVSQETTSENASPQDTEK
LSTEPKDNSVVVNKETSSNDLAHEMVDEEQD
Download sequence
Identical sequences A0A151LVZ9
XP_019970915.1.2076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]