SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020012910.1.5219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020012910.1.5219
Domain Number 1 Region: 63-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000487
Family EGF-type module 0.018
Further Details:      
 
Domain Number 2 Region: 98-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000343
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 3 Region: 24-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000319
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 4 Region: 139-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000028
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020012910.1.5219
Sequence length 171
Comment notch homolog 2 N-terminal-like protein [Castor canadensis]; AA=GCF_001984765.1; RF=representative genome; TAX=51338; STAX=51338; NAME=Castor canadensis; AL=Scaffold; RT=Major
Sequence
MLGKATCRCAPGFTGEECQYSTSHPCFASRPCLNGGTCHMLSWDTYECTCQVGFTGKLCQ
WTDACLSHPCANGSTCTTVANQFSCRCLAGFTGQKCETDVNECDIPGHCQHGGTCLNLPG
SYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLPGEEF
Download sequence
Identical sequences XP_020012910.1.5219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]