SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020017329.1.5219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020017329.1.5219
Domain Number 1 Region: 198-234
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000101
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000144
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 3 Region: 145-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000392
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  XP_020017329.1.5219
Domain Number - Region: 38-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000903
Family CCCH zinc finger 0.0058
Further Details:      
 
Domain Number - Region: 119-143
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00392
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 91-119
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0262
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020017329.1.5219
Sequence length 243
Comment cleavage and polyadenylation specificity factor subunit 4 isoform X3 [Castor canadensis]; AA=GCF_001984765.1; RF=representative genome; TAX=51338; STAX=51338; NAME=Castor canadensis; AL=Scaffold; RT=Major
Sequence
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPTKRAPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFL
SGQ
Download sequence
Identical sequences A0A1S3AKF1 A0A1U7QVH1 A0A287CS09 B2LVG5 Q5FVR7
ENSMUSP00000124899 NP_001012351.1.100692 NP_001012351.1.4139 NP_001278178.1.92730 XP_004629701.1.9945 XP_004692008.1.23501 XP_004774999.1.14098 XP_005079972.1.91757 XP_005339794.1.77405 XP_005368122.1.66349 XP_005598564.1.31192 XP_006748329.1.47382 XP_006913415.1.64745 XP_006942011.1.62641 XP_006982732.1.50099 XP_007536346.1.11023 XP_007615092.1.28591 XP_007648508.1.69978 XP_008139598.1.99482 XP_008696586.1.72690 XP_011229322.1.58354 XP_011383907.1.92234 XP_013008090.1.53824 XP_014651101.1.5094 XP_014711468.1.49734 XP_016073267.1.3490 XP_019278181.1.44245 XP_020017329.1.5219 XP_021042899.1.100879 XP_021535894.1.83697 10116.ENSRNOP00000046991 ENSRNOP00000046991 ENSRNOP00000001304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]