SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020031194.1.5219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020031194.1.5219
Domain Number 1 Region: 53-549
Classification Level Classification E-value
Superfamily Sema domain 5.62e-100
Family Sema domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1410-1534,1700-1881
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-33
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 981-1071
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000443
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.057
Further Details:      
 
Domain Number 4 Region: 890-981
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000817
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 5 Region: 1068-1149
Classification Level Classification E-value
Superfamily E set domains 0.00000000000525
Family E-set domains of sugar-utilizing enzymes 0.061
Further Details:      
 
Domain Number 6 Region: 552-604
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000654
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020031194.1.5219
Sequence length 1924
Comment LOW QUALITY PROTEIN: plexin-D1 [Castor canadensis]; AA=GCF_001984765.1; RF=representative genome; TAX=51338; STAX=51338; NAME=Castor canadensis; AL=Scaffold; RT=Major
Sequence
MARRAAGGAPLSARAAAAAPLPPRPPSGAPACPPLLPLLLLLGAARAGALEIQRRFPSPT
PTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHP
RRLTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVHFPPAAPPAEPVTVFP
SMLNVAANHPNASTVGLVLPPAAGXGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPE
IAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPAAPPPGAQTYA
YLALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSR
LVSVFPARELLFAVFERPQGAPAARAAPAALCAFRFADVQAAIRAARTACFVEPAPDVVA
VLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSILQPLKASPVFRAPGLTAVAVA
SANNYTAVFLGTANGRLLKINLNESMQVVSRCVLTVAYGEPVHHVMQFDPADSGYLYLMT
SHQMARVKVAACEVHSTCRDCVGAADAYCGWCALETRCTLQQDCANSSQPHFWTSASEGP
SRCPSMAVLPAEIDVRQEYTGMILQISGSLPSLSSMEMACDYGNDIRTVARVPGPAYDHQ
IAYCNLLPQDQFPPFPPHQDHVTVEMAVRVNGHNIVSANFTIYDCSRIGQVYPHAACTSC
LSAPWPCFWCAQQHSCVSNQSRCEALPNPTSPQDCPQILPVTLAPMPTGGSQDILVPLTS
AAAFHGAALECSFGLEEGFEAVWLNESVVRCSQVVLHTTQKSQVFPLSLQLKGQPSRFLD
SPDPMTVEVYNCAMGSPDCSQCLGREDLGHLCMWSDSCRLRGPLQPPPGTCPAPEIRTIE
PLSGPLDGGTLLTIRGRNLGRRLSDVTHGVWIGTVACEPXADRYTVSEEIVCITGPAPGS
FSDVVTVNASKEGQSQERFSYVLPTVHSLEPAMGPKAGGTRITIHGSDLHVGSQLQVLVN
NTDPCTELLRTDTSITCTVPGGALPAPVPVCVRFEHRGCVPGNLTFWYMQNPVITAISPI
RSPVSGGRTITVAGERFHMVQNVSMSVHHIGREPTLCKVLNSTLITCPSPGALSNASAPV
DFFINGRAYADEVAVTEELLDPAEAQRGGRFRLDYLPNPQFSTAKREKWIKHHPGEPLTL
VIHKEQDSLGLESREYRVKIGQVACDIQIVSDRVIHCSVNESLGTAEGQLPITIQVGNFN
QTIATLQLGGSETAIVVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQ
IREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQT
HSSPAQETHPLLGEWKVPEDRRPSMEEGISLFSSLLSNKHFLIVFVHALEQQKDFAVRDR
CSLASLLTIALHGKLEFYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSIC
MYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVS
FQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYILR
DLDDTSVVEDGRKKLNTLAHYKIPEGASLALSLTDKKDNTLGRVKDLDTEKYFHLVLPTD
ELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFF
DFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLSVIAQA
FIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYRQIQDMTPLSEQEMNAHLAEES
RKYQNEFNTKVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMENNIYEC
YSEA
Download sequence
Identical sequences XP_020031194.1.5219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]