SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020041524.1.5219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020041524.1.5219
Domain Number 1 Region: 173-598
Classification Level Classification E-value
Superfamily Sema domain 1.7e-99
Family Sema domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1495-1623,1820-1971
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.77e-38
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 959-1054
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000331
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 1051-1140
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000369
Family Other IPT/TIG domains 0.036
Further Details:      
 
Domain Number 5 Region: 601-653
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000593
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 1139-1183,1221-1274
Classification Level Classification E-value
Superfamily E set domains 0.000000128
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020041524.1.5219
Sequence length 2039
Comment plexin-B3 [Castor canadensis]; AA=GCF_001984765.1; RF=representative genome; TAX=51338; STAX=51338; NAME=Castor canadensis; AL=Scaffold; RT=Major
Sequence
MEPMGTLWKGKGAGRKGLGCQARPRWAACVGLGTIALWGGKLGLTPDTVSCSSGPQVAHP
ATQPAQPGGRSHLPPALPWSPLLLHTVEEAGTPARVPLQHGLECSDPRMPYDASSVGFPH
YHAVPGTTFTSLQGRGWETPLLNSLVVPVMAPWPPFSLHLLLLLLLPFTGAHRFSAPNTT
FNHLALAPGRGTLYVGAVNHVFQLSPELQIEAVAVTGPVVDSPDCVPFRDPAECPQARLT
DNANQLLLVSSRAQELVACGQVRQGVCEKRRLGDVAEVLYQAEDPGDGQFVAANTPGVTT
VGLVVPLPGRDLLLVARGLAGKLSAGVPPLTVRQLAGLQPFSSEGLGRLVVGDFSDYNNS
YVGAFADTHSAYFIFRRRGARTQAEYRSYVARVCLGDANLYSYVEVPFACQGQGLIQAAF
LAPGTLLGAFAAGPSGGQGALCAFPLAKLDRSMEQARRLCYTTGGRGPSGMEEATVEYGV
TSRCVTLPPDSPESYPCGDEHTPSPISGRQSVEAQPLLQLEQPISAVAALQADGHTIAFL
GDTQGQLYKVFLNGSQGQVYHSQQVGPPGSAISPDLLVDSSGRHLYVLTAQQLDRVPVAA
CPQFPDCTSCLQAQDPLCGWCVLQGRCTRKGQCLRAAQPNHWLWSYEEDSHCLHIQSLLP
AHHPRQEQGQVTLSVPRLPTLAVDEYFHCAFGDYDSLAHVEGPHVACVTPPQDQVPLNPP
GTDHVTLPLALMFEDVSVAATNFSFYDCSSAQALQMAAPCRTCVSSLWRCHWCPQSSRCV
YGEHCPEGERTVYSAQEVDVQVRGPEACPQVEGLAGPHLVPVGWESHLALRVQNLQYFRG
LPASYYCWLELPGELQRLPASLEETTGGAGLIHCQAQQFHASMSQRELLVPIYVTRGEVQ
RLDNARTLHVTLYDCAVGHPDCSHCQAANESLSCLWCSDGQPACRYGPLCPPGAVEQLCP
TPRIDSIEPLTGPPEGGLALTILGSNLGRAFADIQDAVSVAGQPCSPDPSLYRTSARIVC
VTSPAPNGMAGPVQVAIKSRPPGISTQHFTYQDPILLSLSPQWGPQAGGTQLTIHGQHLQ
TGGNISAFVGDQPCPIQEPVCPEAIVCRTMPQAVPGEAVVLVVFGHAERRLLTSPFRYTA
NPQLVAAEPSVSFRGGGRLIRVRGTGLDVVWQPLLSVWLEAEAEVKALGAQYQDLNPRRS
CSATTVDPQTCIQLERGLLQCSTVCSINSSSLLLCRSPAVPDGTHPKRVFFALDNVHVDF
SSASGGQGFLYQPNPRLAPLSREGLSHPYRLKPGHVLDVEGEGLNLGISKEEVRVHIGDG
ECLVKTLTLTHLYCEPPPRAPQPTNGSSALLQFVVQMGNVRLALGPVQYEAEPTMSAFPV
EAQVGLGMGAAVLIAAVLLLTLMYRHKSKQALRDYQKVLVQLENLEIGVGDQCRKEFTDL
MTEMTDLSSDLEASGIPFLDYHTYAERAFFPGHGGCPLQPELEGPGEEGRRATVCQGLTQ
LSNLLNSKLFLLTLIHTLEEQPTFSQRDRCHVASLLSLALHSKLEYLTDIMRTLLGDLAA
HYVHKNPKLMLRRTETMVEKLLTNWLSICLYAFLKEVAGEPLYMLFRAIKYQVDKGPVDA
VTGKAKRTLNDSHLLREDVEFRPLTLMVLVGPGTGGLAGSSEVQRVPARVLDTDTITQVK
EKVLDQVCKGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVIQNHWKRLNTLQHYKV
PDGATVGLIPQLNNGGVVSQSVAQSCPSGENIPMLEDGEEGGLRFWHLVKAAEEPEGAKA
RRSSLRERERERARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPVPIAVKYLFD
FLDELAEKHGIEDPETLHIWKTNSLLLRFWVNTLKNPQLIFDVRVPGNVDAILAVIAQTF
IDSCTISEHKVGRDSPVNKLLYAREIPRYKQMVEKYYADIRQSSPASYQEMNSTLTELSG
NYTSAPHCLEALQELYNHIHRYYDQIISALEEDPVAQKMQLACRLQQIAALVENKVTDL
Download sequence
Identical sequences XP_020038329.1.5219 XP_020041524.1.5219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]