SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020077222.1.17418 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020077222.1.17418
Domain Number 1 Region: 196-315
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.19e-30
Family cAMP-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 322-435
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-29
Family cAMP-binding domain 0.00047
Further Details:      
 
Weak hits

Sequence:  XP_020077222.1.17418
Domain Number - Region: 13-42
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000497
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020077222.1.17418
Sequence length 456
Comment camp-dependent protein kinase regulatory subunit [Hyphopichia burtonii NRRL Y-1933]; AA=GCF_001661395.1; RF=representative genome; TAX=984485; STAX=717740; NAME=Hyphopichia burtonii NRRL Y-1933; strain=NRRL Y-1933; AL=Scaffold; RT=Major
Sequence
MTPTANQEFITNELNQLQKEIIGKNPVDVLQFCANYFNAKLELQRSQLWSQQIKAKAAGI
NLFPQVDNINVNGTGNGVTVNSRQPSFKSPFGDNDPHSIQHENNSKNDGEKQEDKAGLFK
GGFGVGQETLSKPLQELDPNDPSANSHSNTSTNSNPNPIPAKIPVAFNANRRTSVSAEAL
NPDKFKSDSWKPPTNDLTASQKSELQKTLTSNFLFKQLDENLKKTVIDVLTRKQFKKNDE
IIKQGDEGDFFYIIENGTVDFYVNGTKVNSSGEGSSFGELALMYNSPRAATAIAASDDGV
NCWALDRLTFRRILLEGTFNKRIMYENFLKDVKVLSSLSSHERSKLADALSTEIYHKGDK
IVKEGEQGENFYFIESGTCQISKENAGVVAKISKGDYFGEVALLNDLPRQATVEALDTVI
VATLGKSGFSRLLGPAVDVLKSQDPTAIPDATTAVN
Download sequence
Identical sequences A0A1E4RM24
jgi|Hypbu1|108612|e_gw1.3.1930.1 XP_020077222.1.17418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]