SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020139501.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020139501.1.48125
Domain Number 1 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 212-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 576-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.56e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-21
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 7 Region: 268-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 34-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-21
Family KRAB domain (Kruppel-associated box) 0.00043
Further Details:      
 
Domain Number 9 Region: 174-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 10 Region: 618-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.91e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 11 Region: 118-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000175
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 12 Region: 313-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000135
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020139501.1.48125
Sequence length 677
Comment LOW QUALITY PROTEIN: zinc finger protein 709 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MFGHHRIICELFINRLYIPDAVSLTHSPVHVCGMFXDLVAFEDVAVNFTQEEWALLDHSQ
KKLYRDVMQETFINLASIGKKWEDQNIEDQYKNQGRHLRSHTAERLCKRKEGNQFEETFS
QTPNLKLKKRTLTGVKPYECSVCEKVYMCHSSLKRHMRSHTENRPYGYHKYGEKSYECKE
CGKRFNFRSSFRIHERTHTGEKPYECKQCGKAFSWPSSFQIHERTHTGEKPYECKECGKA
FIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSFRNHERTHSGEKPYECKQCGKAFRYY
QTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSHERIHTGEKPYKCKKCGKAFSFPSSFR
KHERIHTGEKPYDCKECGKAFISLPSFRRHMIMHTGNGPYKCKECGKAFDCPSSFQIHER
THTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPHECKQCGKAFSCSSSVRIHERTHTG
EKPYECKQCGKAFSCSSSFRMHERIHTGEKPYECKQCGKAFSFSSSFRMHERTHTGEKPY
ECKQCGKAFSCSSSFRMHERTHTGEKPYECKQCGKAFSCSSSIRIHERTHTGEKPYECKQ
CGKAFSCSSSVRMHERTHSGEKPYECKQCDKAFSCSRSFRIHERTHTGEKPYECQQCGKA
FKCSRSFRIHERTHTGE
Download sequence
Identical sequences XP_020139501.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]