SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020139503.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020139503.1.48125
Domain Number 1 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 262-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-21
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 430-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.59e-21
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 4 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-19
Family KRAB domain (Kruppel-associated box) 0.00076
Further Details:      
 
Domain Number 5 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 346-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.62e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 527-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.04e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 83-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000392
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 392-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000183
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 308-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000211
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 224-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000229
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020139503.1.48125
Sequence length 586
Comment zinc finger protein 709-like isoform X2 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MDLVSFEDVAVNFTLEEWALLDHSQRVLYRDVMWETFRNLQSIGKKQKDQSIEDQYKKQG
RNLRSHMVEKLDDSKEGSQCEQSFSQIPNLSLNKKTHTEVKPYKCSVCGKLFICSSSLNR
HIISHSRHKPYKCREYGEKPYKCKECGKGFSYLQSFKKHKRTHSAEISYKCKDCGKAFSC
RYSLQIHGRTHVGGKPYECKKCGKAFRYLQSAQVHEKSHSGEKPYKCKECGKTFSYRHSV
RKHERNHTSQKYYECKQCGKTYMSSLGFRAHERTHTGEKPYECKKCGKAFMYHYSAQRHE
KTHTGEKPYKCKECGKAFSYHHTAQKHERNHTDQKRYECEQCGKTYMTPLGFRAHVSTHT
GEKLYECKKCGKVFKYSQSMKTHERTHTGDKPYKCKECGEAFSCRYYAQKHERTHTAEKE
YECKTCGKTYISPLGFRTHERTHTGEKPYKCKECGKAFMYLTSVRIHMISHTGDGPYKCK
ECGKAFSCCSSFQKHERTHTGEKPYECKQCGKAFSHSSYIHMHERIHTGEKPYECRECRK
SFSFLTAFQVHMRMHNRNEPYKCQECGKTFRWRASLQKHARRVHTE
Download sequence
Identical sequences XP_020139503.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]