SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020143251.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020143251.1.48125
Domain Number 1 Region: 232-487
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.62e-63
Family Eukaryotic proteases 0.000000182
Further Details:      
 
Domain Number 2 Region: 50-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-26
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 3 Region: 195-241
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000383
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020143251.1.48125
Sequence length 491
Comment complement C1r subcomponent-like protein isoform X1 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MSSSRCLAAEWGNYPWRSPHSAGCPGKMWWLLLWGVLQACPTQGSVLSAQQLSQQLTSPG
YPEPYVKGQQSTVDIEAPEGFAVRLVFQDFDLEPSRDCERDSVTISAGGTDLSRFCGLQG
SPLGSPPGQREFVSSGRSLRLTFHTHSSSEDKATHLHRGFLALYQAVAVSCRQPTSWASV
GSEAISTPGDSPAEIQNPCQEPYYQAVAAGTLTCKAPGTWKDREGREEAPRCVPVCGWPV
VPVAQNQTTPGSPRAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIFPKDSVSLRRK
LSVHVFLGHTDINEMLKLGSYPVRRVVVHPDYRQNESHNFNADIALLELQRSVPLGPLVL
PVCLPDSETLYASGVQGYVSGFGVEMGWLTTKLKYSRLPVAPREACEAWLRGKRRTEVFS
DNMFCVGDEIQKNGVCQGDSGSVYVVWDDHARRWVATGIVSWGIGCNTGYGFYTKVLNYL
DWIQGVMDGRD
Download sequence
Identical sequences XP_020143250.1.48125 XP_020143251.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]